KEGG   Corynebacterium variabile: CVAR_2762Help
Entry
CVAR_2762         CDS       T01594                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cva  Corynebacterium variabile
Pathway
cva00020  Citrate cycle (TCA cycle)
cva00190  Oxidative phosphorylation
cva00650  Butanoate metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVAR_2762 (sdhA)
   00650 Butanoate metabolism
    CVAR_2762 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CVAR_2762 (sdhA)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CVAR_2762 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CVAR_2762 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO GIDA NAD_binding_8 HI0933_like AlaDh_PNT_C Pyr_redox_2 Pyr_redox FAD_binding_3 His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEK38101
UniProt: G0HHZ7
LinkDB All DBs
Position
complement(3099959..3101992)
Genome map
AA seq 677 aa AA seqDB search
MGMSKPHPHNQTADFNYDEALAAFQAPESQVDGVAVGKVIGDNAPHEVSQQQQWQFDKEH
FKLVSPLNRAKFKVLIVGTGLAGGAAAAALGELGYNVKVFTYHDSPRRAHSIAAQGGVNS
SRAKRLDNDSTYNHTKDTVKGGDYRCRENDCWRLAMESGRVIDHMNAIGAPFSREYGGTL
ANRSFGGVQVSRTFYTRGQTGQQLQLATTSALYRQIGAGNVEIFTHSDVQDVIVEDGVCK
GIVTRNIITGELSIHTGHVTVFATGGYGNVYHMSTLAKNSNASAIMRAYEQGAYMASPSF
VQFHPTGLPVNSDWQSKTILMSESLRNDGRIWTPKKKDDQRDPMTIPEDERDYFLERRYP
AFGNLVPRDIASRANAQQINAGYGVGPKKNSVYLDLTHAIKNLGEDVIRERYSNLIQMYE
EAIGDDAYKTPMRIAPTCHYTMGGLWTDFHEMTSIPGLFCSGESSWMYHGANRLGANSLL
SSSVEGWFTLPFTIPNYLAPLLGTDIPDEDSAAAKAALKRTEDRLNNILNIRGPNPHGAE
HYHRQLGEILYRCCGVARNVKEMQEGIDEIRAVRKDFWENVFVPGGTAEMNQQLEYAIRV
ADYLDLGELMCVDALDRDESCGAHYREDHLDEEGEAKRDDDNWCFISAWEPAGDEKFIRH
SEPLYFDRIPLMTRNYK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagcaagccccacccgcacaaccagaccgctgacttcaactacgacgaggca
ctggcagcattccaggccccggagtcccaggtcgacggcgtggccgtcggcaaggtcatc
ggtgacaacgccccgcacgaggtgtcacagcagcagcagtggcagttcgacaaggagcac
ttcaagctggtctccccgctgaaccgtgcgaagttcaaggtcctcatcgtcggcaccggc
ctcgccggtggcgccgccgcagccgccctcggtgagctcggctacaacgtgaaggtcttc
acctaccacgacagcccccgccgcgcgcactccatcgccgcgcagggtggcgtcaactcc
tcgcgcgccaagcgactggacaacgactcgacctacaaccacaccaaggacaccgtcaag
ggcggcgactaccggtgccgggagaatgactgctggcgtctcgccatggagtccggtcgc
gtcatcgaccacatgaacgccatcggcgccccgttctcccgtgagtacggcggaaccctg
gccaaccgttccttcggtggtgtgcaggtgtcccgcaccttctacacccgtggtcagacc
ggtcagcagctgcagctggccaccacctctgccctgtaccgccagatcggtgccggcaac
gtggagatcttcacccactccgacgtccaggacgtcatcgtggaggacggcgtctgcaag
ggcatcgtcacccgcaacatcatcaccggtgagctcagcatccacaccggtcacgtcacc
gtcttcgccaccggcggttacggcaacgtgtaccacatgtccacgctggccaagaactcc
aacgccagcgcgatcatgcgtgcctacgagcagggtgcctacatggcgtccccgtccttc
gtgcagttccacccgaccggtctcccggtcaactcggactggcagtccaagacgatcctg
atgtccgagtcgctgcgtaacgacggccgcatctggaccccgaagaagaaggacgaccag
cgggatccgatgacgatccccgaggacgagcgcgactacttcctcgagcgtcgctacccg
gccttcggcaacctggtcccgcgtgacatcgcctcccgtgcgaacgcgcagcagatcaac
gccggctacggtgtgggcccgaagaagaactcggtctacctcgacctgacccacgccatc
aagaacctcggcgaggacgtcatccgcgagcggtactccaacctcatccagatgtacgag
gaggccatcggagacgacgcctacaagaccccgatgcgcatcgccccgacctgccactac
accatgggtggtctgtggaccgacttccacgagatgacctcgatcccgggtctgttctgc
tccggtgagtcttcctggatgtaccacggtgcgaaccgactgggtgcgaactccctgctg
tcctcctcggtcgaaggctggttcaccctgcccttcaccatcccgaactacctggctccg
ctgctgggtacggacatcccggacgaggactccgccgccgcgaaggcagcgctcaagcgc
accgaggaccgtctcaacaacatcctcaacatccgtggcccgaacccgcacggtgcggag
cactaccaccgccagctcggtgagatcctctaccgctgctgtggtgtggcccgcaacgtc
aaagagatgcaggagggcatcgacgagatccgcgcggtccgcaaggacttctgggagaac
gtcttcgtccccggcggcaccgccgagatgaaccagcagctcgagtacgcgatccgcgtg
gccgactacctggacctcggtgagctcatgtgtgtcgacgccctggaccgtgacgagtcc
tgtggcgcccactaccgtgaggaccacctcgacgaggaaggcgaggcgaagcgcgacgac
gacaactggtgcttcatctccgcctgggagcccgcgggcgacgagaagttcatccggcac
tctgagccgctgtacttcgaccgcatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system