KEGG   Corynebacterium variabile: CVAR_2979Help
Entry
CVAR_2979         CDS       T01594                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cva  Corynebacterium variabile
Pathway
cva00250  Alanine, aspartate and glutamate metabolism
cva00410  beta-Alanine metabolism
cva00430  Taurine and hypotaurine metabolism
cva00650  Butanoate metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva02024  Quorum sensing
Module
cva_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CVAR_2979 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CVAR_2979 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_2979 (gadB)
   00430 Taurine and hypotaurine metabolism
    CVAR_2979 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CVAR_2979 (gadB)
Enzymes [BR:cva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CVAR_2979 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEK38321
UniProt: G0HI59
LinkDB All DBs
Position
complement(3362573..3363967)
Genome map
AA seq 464 aa AA seqDB search
MSDLELNPLFARTDEATSFPRHRIPEAGSLPETAYQLIHDEAMLDGNARMNLATFVGTWM
DDHANRLYSEAFDKNMIDKDEYPATAEIEDRCWRMIARLWNAPDPDHTMGTSTVGSSEAC
MFGGLALKRRWQHRRRAAGESTERPNIVLSSAVQVCWEKFCNYFDVEPRYVPVSEEHRVL
DGHDLDSYVDENTIGVVAILGVTYTGMYEPVAAIAAALDEIEDRRGLDIRIHVDAASGGM
IAPFLQPDLEWDFRLPRVASINTSGHKYGLVYPGLGWIVWRTQEDLPEDLVFRVSYLGGD
MPTLALNFSRPGAQVLLQYYLFLQLGMDGYRRVQGTTMEVARYLAGEIGKMPDFELWSED
LDIPVFAWRLAGEDAWGDARRERKWTLYDLSDRLRMHGWQVPAYPMPDDLSDVTVQRIVV
RNGMSHDLATLFVRDLRTCVRYLDGLDAPLPSTADGGQGTGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcgaactcaacccgctgttcgcccgcaccgacgaggcgaccagtttcccg
cgtcaccgcatcccggaggccggcagcctgccggagaccgcgtaccagctcatccacgat
gaggcgatgctcgacggcaacgctcggatgaacctcgccaccttcgtcggcacgtggatg
gacgaccacgcgaaccggctgtacagcgaggccttcgacaagaacatgatcgacaaggac
gagtaccccgccaccgcggagatcgaggaccgctgctggcggatgatcgcccggctgtgg
aacgcacccgatcctgaccacaccatgggcacctccaccgtcgggtcctcggaggcgtgc
atgttcggtggcctggcgctgaagcggcggtggcagcaccggcgtcgcgcggcgggggaa
tccaccgagcggccgaatatcgtgctgtcctcggcggtgcaggtgtgctgggagaagttc
tgcaactacttcgacgtcgagccccgctacgtgccggtcagtgaggaacaccgcgtcctc
gacggtcatgacctggacagctacgtcgacgagaacaccatcggcgtggtcgcgatcctg
ggcgtgacctacaccggcatgtatgagccggtggccgcgatcgccgccgcgctcgacgag
atcgaggaccgacgtggcctggacatccggatccacgtggacgccgcgtccggcgggatg
atcgccccgttcctgcagccggacctggaatgggacttccggctgccacgggtggcctcg
atcaacacgtccgggcacaagtacggactcgtctacccggggctgggctggatcgtgtgg
cgcacgcaggaggatctgccggaggacctggtcttccgcgtcagctacctcggcggggac
atgccgacgctggccctgaacttctcccggccgggcgcgcaggtgctgctgcagtactac
ctgttcctgcagctggggatggacggctaccggcgggtgcagggcaccacgatggaggtg
gcgcggtacctcgccggcgagatcgggaagatgccggacttcgagctgtggagtgaggac
ctggacattccggtgttcgcgtggcggttggcgggggaggacgcgtggggtgacgcgcgc
cgggagcggaagtggacgctctacgatctctcggaccggctgcggatgcacggctggcag
gtaccggcgtaccccatgccggacgacctcagtgatgtgacggtgcagcgcatcgtcgtg
cgcaacgggatgagccacgacctggcgacgctgttcgtccgggacctgcgcacctgcgtg
cggtacctcgacgggctggatgcgccgttgccgtccactgctgacggtgggcaggggacg
gggttccatcactga

DBGET integrated database retrieval system