KEGG   Chromobacterium vaccinii: BKX93_04135Help
Entry
BKX93_04135       CDS       T04565                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00071  Fatty acid degradation
cvc00280  Valine, leucine and isoleucine degradation
cvc00281  Geraniol degradation
cvc00362  Benzoate degradation
cvc00592  alpha-Linolenic acid metabolism
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01212  Fatty acid metabolism
Module
cvc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKX93_04135
   00592 alpha-Linolenic acid metabolism
    BKX93_04135
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKX93_04135
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BKX93_04135
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKX93_04135
   00642 Ethylbenzene degradation
    BKX93_04135
Enzymes [BR:cvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BKX93_04135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOZ49268
UniProt: A0A1D9LDD7
LinkDB All DBs
Position
complement(933711..934913)
Genome map
AA seq 400 aa AA seqDB search
MSKQVQEAYIVAATRTPVGKAPRGMMRNVRPDDMLAHVITGALAQVPNLDPKLISDCVVG
CAFPEAEQGLNMARIGVLLAGLPNTVGGITINRYCSSGINAVQMAADRIRLGEADVVIAA
GSESMSLVPMMGNKVSLNPEIFAKDENYGIAYGMGLTAEKVAQQWGVSREDQDAFAVESH
RRALAAIDGGKFKSEITPLEVTYRTPNLETGEVIAKTRVLDTDEGPRRETTLEGLAKLKT
VFDAKGSVTAGNSSQMSDGAGAVILVSERVLKEFNLVPLARYVTFSVKGVPPEIMGIGPK
EAIPAALAQAGLKQDDLKWIELNEAFAAQALAVARDLELDMSKVNPHGGAIALGHPLGAT
GAIRTATLVHGMRDAGLKGHGMVTMCIGTGMGAAGIIEVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaagtacaagaagcttacattgtcgccgccacccgcactccggtgggtaag
gcgccgcgcggcatgatgcgcaatgtgcgtccggacgatatgctggcgcatgtgatcacc
ggcgcgctggcgcaagtgccgaacctggatccgaagctgatttccgactgcgtggtcggc
tgcgccttcccggaagcggagcagggcctgaacatggcgcgcatcggcgtgttgctggca
ggtctgcccaacacagtgggcggcatcaccatcaaccgctactgctcgtccggcatcaac
gccgtgcagatggcggccgaccgcatccgcctcggcgaagccgacgtggtgatcgcagcc
ggttccgaatcgatgtccctggtgccgatgatgggcaacaaggtgtcgctgaacccggaa
atcttcgccaaggacgagaattacggcatcgcctacggcatgggtctgaccgctgaaaaa
gtggcccagcaatggggcgtgtcgcgcgaagaccaggacgcgttcgcggtggaatcccac
cgccgcgcgctggccgcgatcgacggcggcaagttcaagagcgagatcactccgctggaa
gtgacctaccgcacgcctaacctggaaaccggcgaagtcatcgccaagacccgcgtgctg
gacaccgacgaaggcccgcgccgcgagactacgctggaaggcctggccaagctgaagacc
gtgttcgacgccaagggttcggtcaccgccggcaactcttcgcagatgtccgatggcgcc
ggcgcggtgatcctggtgtccgagcgcgtgctgaaggagttcaacctggtgccgctggcc
cgctacgtgaccttctcggtcaagggcgtgccgccggaaatcatgggcatcggtccgaag
gaagccatcccggccgcgctggcccaggccggcctgaagcaggacgacctgaagtggatc
gaattgaacgaagccttcgccgcccaggcgctggccgtcgcgcgcgatctggagctcgac
atgtccaaggtgaacccgcacggcggcgcgatcgctctgggccacccgttgggcgcgacc
ggcgcgatccgcaccgccacgctggtgcacggcatgcgcgacgcaggcctgaagggccac
ggcatggtgacgatgtgcatcggcaccggcatgggcgccgccggcatcattgaggtgctg
taa

DBGET integrated database retrieval system