KEGG   Chromobacterium vaccinii: BKX93_08205Help
Entry
BKX93_08205       CDS       T04565                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00500  Starch and sucrose metabolism
cvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKX93_08205
Enzymes [BR:cvc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BKX93_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AOZ52787
UniProt: A0A1D9LND2
LinkDB All DBs
Position
1779861..1782470
Genome map
AA seq 869 aa AA seqDB search
MTRPALLGVLIAALFSPTIQAAEAFGAPGAAPVRGPASKSFVGTAVNSPSRVYFTGYRGI
VSEVYYPALDTPESVDLQFLVGDAGKTFVDEEKRQAYSAGQSDKRTMSWIASTGNDGHNW
RISKRIFADPNRDALVQRVTFTALNGHTVGDFNLYVLFKPYLDNSGSGNSAQTVAAAGGY
ALAASRNSRASALMASLPWKTVNGQAMLSNGFVGQSDGWTDLIGSGDNTMNWTYGSATNG
NVAQTGWLDLGDPAAASVSFDMALGFGKSQGDAVNAAAASLGSDLSAAQQQYDNAWHAYA
AGLSTQGGLADDRYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDANQGGYHLVWPRDL
FKFANALYTAGDAATASTVVGYLFNTLQQGSDCGAAEYNAPGCAAGFSRVGRFPQNAWIS
GWPYWQGTQMDEQAMPILLAWRLGPSVSNPLWPKIKLTADYIVATGPWSYQERWEENSGY
SPSTLAAEIAGLVAAADIARANGDDASAGRYLSAADYWQQNVAAWTYTTSGGFGNGSYYI
RINPANRAGSGADRASFNPSAGPDTPQTLTVKNGGGSHDARRVVDGGFLELVRMGVKRAD
DPTIVNTMSVFDSVLGQYLALPGAPKLPANAWFRYNFDGYGEHNDGGDFDGAGVGRLWPI
FTAERGMYEIARQGAGSAGQPYFSTLKLLATPEGMLPEQVWSNSATLPDGWAVTTPPGYQ
PGSATNSMGPLNWAMGEYISLLASINAGRIVDVPQAVCARYNNCRAAPKAGEVAVAINAS
AGTQWGQQVYITGNARALGNWNTDLGIPLDAAAYPSWRNGVNLPAGQQIAYKYYRKNADG
SVSWENRSGNRSLQTPASGSLNLNDQVSW
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
ctgacccgccccgcgcttttgggcgtcctgatcgccgccctgttctcacccaccatccag
gccgcggaggctttcggcgcgcccggcgccgcgccggtccgcggcccggcttccaagtcc
ttcgtcggcaccgcggtcaacagcccttcccgcgtctacttcactggctatcgcggcatc
gtgtccgaggtgtattacccggcgctggacacgccggaatcggtggatctgcagtttctg
gtcggcgacgccggcaagaccttcgtcgacgaggagaaacgccaggcctactccgccggc
cagagcgacaaacgcacgatgagctggatcgccagcaccggcaatgatggccacaattgg
cggatcagcaaacgcatcttcgccgaccccaaccgcgacgcgctggtgcagcgcgtgacc
ttcaccgcgctgaacggccatacagtcggcgacttcaatctatacgtgctgttcaagccc
tatctcgacaactccggcagcggcaacagcgcccagaccgtggccgcagccggcggctac
gcgctggcggccagccgcaacagccgcgcctcggcgctgatggccagcctgccatggaag
accgtcaacggccaggccatgctgtccaacggcttcgtcggccagagcgacggctggacc
gatctgataggcagcggcgacaacacgatgaattggacctacggctcggccaccaacggc
aacgtcgcccagaccggctggctggacctgggcgatccggccgcggccagcgtgtctttc
gacatggcgctgggcttcggcaaaagccagggcgacgccgtcaacgccgccgccgcgtcc
ttgggcagcgatctttcagccgcgcaacagcagtacgacaacgcctggcacgcctacgcc
gccggcctgtccacccagggcggcctggccgacgaccgctactacctggcggcgatgacg
ctgaagacgatgcaggacaagagcaacggcgcgatgatcgccggcatcggcacgccatgg
ggcgagacccagggcgacgccaatcagggcggctaccacctggtatggccgcgcgacctg
ttcaagttcgccaacgccctctataccgccggcgacgccgccacggcgtccacggtggtg
ggctaccttttcaacacgctgcagcagggcagcgactgcggcgcggcggaatacaacgcg
ccaggctgcgccgccggcttcagccgtgtcggccgcttcccgcagaacgcctggatcagc
ggctggccgtactggcagggcacgcagatggacgagcaggcgatgcccatcctgctggcc
tggcggctggggccgtccgtttccaatccgctgtggcccaagatcaagctgaccgccgac
tacatcgtcgccaccggcccgtggagctaccaggagcgctgggaggagaactccggctac
tcgccgtcgaccctcgccgccgagatcgccggcctggtggccgccgccgacatcgcccgc
gccaacggcgacgacgccagcgccggccgctacctgtccgccgccgactactggcagcag
aacgtcgccgcctggacctataccaccagcggcggcttcggcaacggcagctactacatc
cggatcaatccggccaatcgcgcgggaagcggcgccgaccgcgccagcttcaatccgtcc
gccgggccggatacgcctcagacgctgacggtgaagaacggcggcggcagccatgacgcg
cgccgcgtggtggacggcggctttctggagttggtgcggatgggcgtcaaacgcgccgac
gaccccaccatcgtcaacaccatgtcggtattcgacagcgtgctcggccaatacctggcg
ctgcccggcgcgcccaagctgccggctaacgcctggttccgctacaacttcgacggctac
ggcgagcacaacgacggcggcgacttcgatggcgcgggcgtcggccggctgtggccgatc
ttcaccgccgagcgcggcatgtacgaaatcgcccgccagggggcgggcagcgccggccaa
ccgtacttctccacgctgaagctgctggccacgccggaaggcatgctgccggagcaggta
tggtcgaacagcgccacgctgccggacggctgggcggtgaccacgccgcccggctaccag
ccgggcagcgccaccaactcaatggggccgctgaactgggcgatgggcgaatacatcagc
ctgctggcctcgatcaacgccggccgcatcgtcgatgttccgcaagcggtctgcgcccgc
tacaacaactgccgcgccgcgcccaaggccggcgaggtggcggtggccatcaacgccagc
gccggcacgcagtggggccagcaggtctacatcaccggcaatgcccgcgcgctgggcaac
tggaacaccgacctcggcatcccgctggacgcggccgcctatccttcgtggcgaaacggc
gtcaacttgccggccggccaacagatcgcctacaagtactaccgcaagaacgccgacggc
agcgtgagctgggagaaccggtccggcaaccgcagcctgcagacgccagctagcggcagc
ctcaacctgaacgaccaggtgagctggtga

DBGET integrated database retrieval system