KEGG   Chromobacterium vaccinii: BKX93_09545Help
Entry
BKX93_09545       CDS       T04565                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00061  Fatty acid biosynthesis
cvc00780  Biotin metabolism
cvc01100  Metabolic pathways
cvc01130  Biosynthesis of antibiotics
cvc01212  Fatty acid metabolism
Module
cvc_M00083  Fatty acid biosynthesis, elongation
cvc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BKX93_09545
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BKX93_09545
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BKX93_09545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cvc01004]
    BKX93_09545
Enzymes [BR:cvc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BKX93_09545
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BKX93_09545
Lipid biosynthesis proteins [BR:cvc01004]
 Fatty acid synthase
  Component type
   BKX93_09545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AOZ52809
UniProt: A0A1D9LNJ2
LinkDB All DBs
Position
2051672..2052448
Genome map
AA seq 258 aa AA seqDB search
MESIRNILAGKRGLIVGIANEDSIAYGCASVLHQLGAECAVTYLNAKAEKYVRPLAEQLQ
AKLVLPLDVEQAGQLERVFAEIEKHWGGLDFIIHSIAYCPMEDLHGRVTDCSLAGFQQAM
RVSCYSFIEMARLAEPLMKRGGSLITMSYYGADKVVENYNIMGPVKAALESVSRYLANEL
GPKRIRVHAVSPGPLKTRAASGIAHFDQLIEDAISRAPQNRLVEIEEVGMTCAFLISDAA
SGLTGQTIYVDGGHHIKA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcatacgcaacatcctcgccggcaagagagggctcatcgtcggcatcgccaac
gaagacagcatcgcctacggctgcgccagcgtgctgcatcaactgggcgcggaatgcgcg
gtcacctacctcaacgccaaggccgagaaatacgtgcggccgctggccgaacagctgcag
gccaagctggtgctgccgctggacgtggagcaagccggccagttggagcgcgtgttcgcc
gagatagaaaagcactggggcgggctggacttcatcatccactccatcgcctattgcccg
atggaagacttgcacggccgcgtcaccgactgttcgctggcgggcttccagcaggcgatg
cgggtatcgtgctactcgttcatcgagatggcgcggctggccgagccgctgatgaagcgc
ggcggcagtctgatcacgatgagctattacggcgccgacaaggtggtggaaaactacaac
atcatgggcccggtcaaggcggcgctggaaagcgtgtcccgctacctggccaacgagctc
ggccccaaacgcatccgcgtgcacgcggtgtcgcccggcccgctgaaaacccgcgccgcc
tccggcatcgcgcacttcgaccagttgatcgaagacgccatctcccgcgcgccgcagaat
cgcctggtggagatagaagaagtgggcatgacctgcgccttcctgatttccgacgccgcc
agcggcctgaccggccagaccatctacgtcgacggcggacaccacatcaaggcttga

DBGET integrated database retrieval system