KEGG   Chromobacterium vaccinii: BKX93_10805Help
Entry
BKX93_10805       CDS       T04565                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00550  Peptidoglycan biosynthesis
cvc01100  Metabolic pathways
cvc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKX93_10805
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BKX93_10805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cvc01003]
    BKX93_10805
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cvc01011]
    BKX93_10805
Enzymes [BR:cvc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BKX93_10805
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKX93_10805
Glycosyltransferases [BR:cvc01003]
 Polysaccharide
  Bacterial polysaccharide
   BKX93_10805
Peptidoglycan biosynthesis and degradation proteins [BR:cvc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BKX93_10805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AOZ52834
UniProt: A0A1D9LNS7
LinkDB All DBs
Position
complement(2321162..2323384)
Genome map
AA seq 740 aa AA seqDB search
MPLRVYSADNQLLGEFGEERRSFSRIHEVPQLMKQAVLAAEDERFYQHSGIDYLGIMRAA
VGNLVSGHARSGASTITMQVAKNFFLSSEKTFTRKFNEALLAFKIEHTLSKDQILELYFN
QIYLGQRAYGFAAAAQTYYGKTLNDLSPAQMAMLAGLPKAPSAYNPIVNPDRAKLRQQYV
LRRMRELNFITQEQYDQALAEPLHLAGQVAETSQPGQYVAEMVRQAMYERYKEAAYTEGF
KVYTTVDSRHQKWAYDALRAGLIDYDRKTGYRGPESFLDLPAGDGEDATEALDEAMGDLR
DSGDMLPAIVLSASPSEVRAYMRGGKIASIKGTGLDFARRGLSSKASAQLQIRRGAVIRV
QANAKGYWEIVEMPEVEGAFVSLDTRTGAIKSLIGGFDFNRRSFNHVTQAWRQPGSSFKP
FIYSSGIERGITPSTLINDAPLSVPGVNGQMWTPKNDDGKFSGMITLRQGLTRSKNLVSV
RVLMAVGTDYAQQYLQRFGFSAKQHPAYLPMALGAGSVTPLQMVEGYSVFANGGYRTKAF
FIDRIEDQSGRVLAKTVPTVAGQNAQQAIDPRNAFIMRSMMGDVVRYGTGFRAMSLGRTD
LAGKTGTTSDWKDAWFVGFNPNLAAATWVGFDQPRSLGRYGYGGTAALPIWINYMGNALK
GQPEVELPVPQGIVVKPGAGQRGGDEYYYEEFQKTNPELHIDNQGSVPGSEGDASAPLSD
TDSGKPAAQDAVENVKDQLF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
attccgctccgcgtctactccgccgacaaccagttgttgggcgaattcggcgaagagcgg
cgttcgttttcccgcatccatgaagtgccgcagctgatgaagcaggcggtgctggcggcc
gaggacgagcgcttctatcagcatagcggcatcgactacctcggcatcatgcgcgccgcc
gtcggcaacctggtgtccggccatgcccgctccggcgccagcaccatcaccatgcaggtg
gcgaagaacttcttcctgtccagcgagaaaaccttcacccgcaagttcaacgaagcgctg
ctggcgttcaagatcgagcacacgctgagcaaggaccagattctggaactgtacttcaac
cagatctaccttgggcagcgggcctacggcttcgccgccgcggcgcagacgtattacggc
aagacgctcaacgacctgagccccgcccagatggcgatgctggccggcctgcccaaggcg
ccgtcggcttacaaccccatagtcaatcccgaccgcgccaagttgcgccagcaatatgtg
ctgcgtcgcatgcgcgagctgaacttcatcacccaggagcagtacgaccaggcgctggcc
gagccgctgcatctggccggccaggtggcggaaaccagccagcccggccagtatgttgcg
gaaatggtacggcaggcgatgtacgagcgttacaaggaagcggcgtacaccgaaggcttc
aaggtctacaccaccgtggacagccgccaccagaaatgggcgtacgacgcgctgcgcgcc
ggtctgatcgattacgaccgcaagaccggctaccgcggtccggagagctttctggatctg
ccggccggcgacggcgaggacgccaccgaggcattggacgaggcgatgggcgatctgcgc
gacagcggcgacatgctgccggccatcgtgctgtcggccagcccgtccgaggtgcgcgcc
tacatgcgcggtggcaagatcgcgtcgatcaagggcacgggcctcgatttcgcccgccgc
gggctgagcagcaaggcgtcggcccagctgcaaatccgccgcggcgcggtgatccgcgtg
caggccaacgccaagggctattgggagatcgtggagatgccggaagtggagggcgccttc
gtgtcgctcgacacccgcaccggcgcgatcaagtcgctgatcggcggcttcgacttcaac
cgccgcagcttcaaccacgtgacccaggcctggcgccagccgggctcctcgttcaagccc
ttcatctactcgtcgggcatcgagcgcggcatcacgccgtccacgctgatcaacgacgcg
ccgctgtcggtgcccggggtcaacggtcagatgtggacgcccaaaaacgacgacggcaag
ttctccggcatgatcaccctgcgccagggtctgacccgctccaagaacctggtatcggtg
cgcgtgctgatggcggtgggcaccgactacgcccagcaatacctgcagcgcttcggcttc
tccgccaagcagcatccggcctatctgccgatggcgctgggcgcgggctcggtgacgccg
ctgcagatggtggagggctactcggtgttcgccaacggcggctaccgcaccaaggccttc
ttcatcgaccgcatcgaagaccagtccggccgcgtgctggccaagaccgtgcccaccgtg
gccggccagaacgcccagcaggcgatcgatccgcgcaacgccttcatcatgcgctcgatg
atgggcgacgtggtccgctacggcactggcttccgcgcgatgagcctgggccgcaccgat
ctggccggcaagaccggcaccacctcggactggaaggacgcctggttcgtcggcttcaat
cccaatctggcggcagccacctgggtgggcttcgaccagccgcgctcgctgggccgctac
ggctacggcggcaccgccgcgctgccgatctggatcaactacatgggcaacgccttgaag
ggacagccggaagtggagctgccggtgccgcagggcatcgtggtgaagccgggcgccggc
cagcgcggcggcgacgagtactactacgaagagttccagaagaccaatccggagctgcat
atcgacaaccagggctcggtgccgggcagcgagggcgacgccagcgcgccgctgtcggac
accgacagcggcaagcccgccgcccaggacgcggtggagaacgtcaaggatcagctgttc
tga

DBGET integrated database retrieval system