KEGG   Chromobacterium vaccinii: BKX93_15590Help
Entry
BKX93_15590       CDS       T04565                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00970  Aminoacyl-tRNA biosynthesis
cvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKX93_15590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cvc03029]
    BKX93_15590
Enzymes [BR:cvc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BKX93_15590
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BKX93_15590
Mitochondrial biogenesis [BR:cvc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BKX93_15590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOZ52916
UniProt: A0A1D9LNN7
LinkDB All DBs
Position
3370773..3372224
Genome map
AA seq 483 aa AA seqDB search
MTQATLKQLSQQLAAKQVSSVELASQYLDRIEALNPQLNAIVTTDREKTLAEARAADARI
AAGDAHPLTGVPLVHKDLFCQQGWKTSCGSKMLDNFVSPYSAHVVEQCAAAGMVTLGRAN
MDEFAMGSSNENSFYGAVRNPWDAKAIPGGSSGGSAAAVAARLAPVATATDTGGSIRQPA
SHCGVTGIKPTYGVVSRYGMVAFASSLDQGGPIAQTAEDCALMLNVMAGFDERDSTSLER
AKEDYSRDLNQSLAGLKVGLPKEYFAAGLDADVARAVDNAVAELKKLGAEAVEIALPNTE
LSIPAYYVIAPAEASTNLSRYDGVRYGHRAKDYKDLVDMYEKTRAEGFGDEVKRRILVGS
YVLSHGYYDAYYLKAQKIRRLIANDFKAAFQQCDVILGPVAPTAAFDLGQMASDPVEMYL
SDVYTLSVNLAGLPGMSVPAGFAANGRPIGLQIIGNYFGEARMLNVAHQFQQATDWHAKA
PAL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagccaccctcaagcaattgtcgcaacagctggcggccaaacaggtttccagc
gtggagctggccagccagtacctggaccgcatcgaggcgctgaacccgcagctcaacgcc
attgtcaccaccgaccgcgaaaagacgctggccgaagcccgcgccgccgacgcccgcatc
gccgccggcgacgcgcatccgctgaccggcgtgccgctggtgcacaaggatctgttctgc
cagcaaggctggaagaccagctgcggctccaagatgctggacaacttcgtttcgccgtac
agcgcccacgtggtggagcaatgcgccgccgccggcatggtgacgctgggccgcgccaat
atggacgagttcgcgatgggctcgtccaatgaaaactcgttctacggcgcggtgaggaac
ccgtgggacgccaaggcgattccgggcggcagctccggcggttccgccgccgccgtcgcc
gcgcgcctggcgccggtggccaccgccaccgataccggcgggtccatccgccagccggcc
agccattgcggcgtcaccggcatcaagccgacctacggcgtggtgtcgcgctacggcatg
gtggccttcgcctcctcgctggaccagggcggcccgatcgcccagaccgccgaggactgc
gcgctgatgctgaacgtgatggccggcttcgacgagcgcgactccaccagcctggagcgc
gccaaggaagactacagccgcgatctgaaccaatccctggccggcctgaaagtgggcctg
cccaaggaatacttcgccgccggcctggatgccgacgtcgcgcgcgctgtcgacaacgcc
gtggccgagctgaagaagctgggcgccgaggcggtggaaatcgcgctgccgaacaccgag
ctgtcgattccggcttattacgtgatcgcgccggccgaggcctcgaccaacctgtcccgc
tacgacggcgtccgctacggccaccgcgccaaggactacaaggatctggtcgacatgtac
gagaagacccgcgccgaaggcttcggcgacgaggtcaagcgccgcatcctggtgggcagc
tacgtgctgagccacggctactacgacgcttactacctgaaggcgcagaagatccgccgc
ctgatcgccaacgacttcaaggccgctttccagcagtgcgacgtgatcctgggaccggtg
gcgccgaccgccgccttcgatttgggccagatggcgtccgatccggtggagatgtatctg
tccgacgtgtatacgctgtcggtgaacctggccggcctgccgggcatgagcgtgccggcc
ggcttcgccgccaacggccgaccgatcggcctgcagatcatcggcaattacttcggcgaa
gccaggatgctgaacgtagcgcaccagttccagcaagcgaccgactggcacgccaaggcg
cccgcgctgtaa

DBGET integrated database retrieval system