KEGG   Chromobacterium vaccinii: BKX93_15650Help
Entry
BKX93_15650       CDS       T04565                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00471  D-Glutamine and D-glutamate metabolism
cvc00550  Peptidoglycan biosynthesis
cvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BKX93_15650
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKX93_15650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cvc01011]
    BKX93_15650
Enzymes [BR:cvc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BKX93_15650
Peptidoglycan biosynthesis and degradation proteins [BR:cvc01011]
 Precursor biosynthesis
  Amino acid ligase
   BKX93_15650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AOZ51294
UniProt: A0A1D9LJ86
LinkDB All DBs
Position
3385345..3386739
Genome map
AA seq 464 aa AA seqDB search
MKHRVKHIHFVGIGGVGMCGIAEVLHGLGYTVSGSDMADGATTKRLAAEGVRVFFGHDAT
YVEGADVVVTSTAVKADNPEVLAARDKRVPVIPRALMLAELMRFKQGIAIAGTHGKTTTT
SLTASVLGAAGLDPTFVIGGKLTAAGANAKLGLGEFLVAEADESDASFLHLSPVMAVVTN
IDADHMDTYDHSFDKLKQAFVDFLQRMPFYGRAVLCVDDPNVREIRERVTKPVTTYGLDD
SADIYAENVRAAAGQMHFDVVVKNGAITRFPLVLNLPGRHNVLNALSAIAIGLECGASIE
AIQKGLSEFAGVGRRFQRYGEVKAQDGGSFTLVDDYGHHPVEMAATLAAVRGAFPGRRLL
LAFQPHRYTRTRDLFEDFVKVLSSVDALLLSEVYAAGEAPIVAADGRALARAVRVGGKVE
PLFVEDIAEMPQAILDAARDGDVVVTMGAGSVGAVPGKVTALAG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacagggtcaaacacatacatttcgtgggcataggcggcgtcggcatgtgcggc
atcgccgaggtgctgcacggcctgggctacaccgtgtcgggttcggacatggccgacggc
gccaccaccaagcggctggccgccgaaggcgtgcgcgtgttcttcggccacgacgccacc
tatgtggaaggcgccgacgtggtggtgacctccaccgcggtgaaggcggacaacccggaa
gtgctggcggcgcgcgacaagcgcgtgccggtgattccgcgcgcgctgatgctggccgag
ctgatgcgcttcaagcagggcatcgccatcgccggcacccacggcaagaccactaccacc
agcctgaccgcgtcggtgctgggcgcggccggactggacccgactttcgtcatcggcggc
aagctgaccgccgccggggccaacgccaagctgggcctgggcgaattcctggtggccgag
gccgacgaatcggacgcgtccttcctgcatctgagcccggtgatggcggtggtgaccaat
atcgacgccgaccacatggacacctacgaccacagtttcgacaagctgaagcaggccttc
gtcgatttcctgcagcggatgccgttttacggccgcgcggtgctgtgcgtcgacgatccc
aacgtgcgcgagatccgcgagcgcgtcaccaagccggtaacgacctacggcctggacgat
tccgccgacatttacgccgagaacgtgcgcgcggccgccggccagatgcatttcgacgtg
gtggtgaagaacggcgccatcacccgcttcccgctggtgttgaacctgccgggccggcac
aacgtgctgaacgcgctgtcggcgatcgccatcggcctggagtgcggcgccagcatcgaa
gccatccagaagggcctgtccgagttcgccggcgtcggccgccgcttccagcgctacggc
gaagtgaaggcccaggacggcggcagcttcacgctggtggacgattacggccatcacccg
gtggaaatggccgccacgctggccgcggtgcgcggcgccttccccggccgccgcctgttg
ctggccttccagccgcaccgctatacccgcacccgcgacctgttcgaggacttcgtcaag
gtgctgtccagcgtcgacgcgctgctgctctccgaggtttacgccgccggagaagcgccc
atcgtcgccgccgacggccgggcgctggcgcgcgcggtgcgcgtgggcggcaaggtggag
ccgctgttcgtcgaggacatcgccgagatgccgcaggccatcctggacgccgcccgcgac
ggcgacgtggtggtgaccatgggcgccggctcggtcggcgcggtgccaggcaaagtgacg
gccctggcgggttga

DBGET integrated database retrieval system