KEGG   Chromobacterium vaccinii: BKX93_18380Help
Entry
BKX93_18380       CDS       T04565                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00020  Citrate cycle (TCA cycle)
cvc00270  Cysteine and methionine metabolism
cvc00620  Pyruvate metabolism
cvc00630  Glyoxylate and dicarboxylate metabolism
cvc00680  Methane metabolism
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01200  Carbon metabolism
Module
cvc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cvc_M00012  Glyoxylate cycle
cvc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKX93_18380
   00620 Pyruvate metabolism
    BKX93_18380
   00630 Glyoxylate and dicarboxylate metabolism
    BKX93_18380
  09102 Energy metabolism
   00680 Methane metabolism
    BKX93_18380
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BKX93_18380
Enzymes [BR:cvc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BKX93_18380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C DAP10
Motif
Other DBs
NCBI-ProteinID: AOZ51766
UniProt: A0A1D9LKH7
LinkDB All DBs
Position
complement(3948487..3949467)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILHLLDLPQAQTALKGVMMELEDC
AFPLLAGMVATDDPNVAFKDVKVALLVGARPRSKGMERKDLLEANGAIFTVQGKALNDHA
ARDVKVLVVGNPANTNAWIAMKSAPDLDPKNFTAMLRLDHNRALSQIAAKTGKPVAAIEK
LAVWGNHSPTMYADYRFATIDGQSVKTLINDDVWNRDVFLPTVGKRGAAIIEARGLSSAA
SAANAAIDHIHDWVLGSNGKWVTMGIPSDGSYGIPEGVMYGVPVVCENGEYKRVEGLEID
AFSRERMDLTLAELEEERAAIAHLFG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccccgttcgcgttgccgttaccggcgctgccggccagatcggctacagcctg
ctgttccgcattgccagtggtgaaatgctgggcaaggatcaaccggtcattcttcacctg
ctggacctgccgcaggctcaaaccgcgctgaagggcgtgatgatggagctggaagactgc
gccttcccgctgttggccggcatggtagccaccgacgacccgaacgtggccttcaaggat
gtgaaagtcgccctgctggtcggcgcccgcccgcgcagcaagggcatggagcgcaaggac
ctgctggaagccaacggcgccatcttcaccgtgcagggcaaggcgctgaacgaccacgcc
gcccgcgacgtcaaggtgctggtggtgggcaacccggccaacaccaacgcctggatcgcg
atgaagtcggctccggatctggatccgaaaaacttcaccgccatgttgcgtcttgaccac
aatcgcgcgctgtcgcaaatcgccgccaagaccggcaagccggtggccgcgatcgagaag
ctggcagtgtggggcaaccactcgccgaccatgtacgccgactaccgcttcgccaccatc
gatggccaatcggtcaagaccctgatcaacgacgacgtgtggaaccgcgacgtgttcctg
cccaccgtgggcaagcgcggcgccgccatcatcgaagcgcgcggcctgtcctccgccgcc
tccgccgccaacgccgccatcgaccacatccacgactgggtgctgggcagcaacggcaag
tgggtgaccatgggcattccgtccgacggctcctacggcatcccggaaggcgtgatgtac
ggcgtaccggttgtatgcgaaaatggcgaatacaaacgtgtagaaggcctggagatcgac
gcgttcagccgcgagcggatggacctgaccctggccgagctggaagaagagcgcgcagcc
atcgctcacctgtttggctga

DBGET integrated database retrieval system