KEGG   Chromobacterium vaccinii: BKX93_18420Help
Entry
BKX93_18420       CDS       T04565                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00020  Citrate cycle (TCA cycle)
cvc00310  Lysine degradation
cvc00380  Tryptophan metabolism
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01200  Carbon metabolism
Module
cvc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKX93_18420
  09105 Amino acid metabolism
   00310 Lysine degradation
    BKX93_18420
   00380 Tryptophan metabolism
    BKX93_18420
Enzymes [BR:cvc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BKX93_18420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II BAF
Motif
Other DBs
NCBI-ProteinID: AOZ51774
UniProt: A0A1D9LKM9
LinkDB All DBs
Position
3955555..3958383
Genome map
AA seq 942 aa AA seqDB search
MMQSMYSHSYLFGGNAPFIEELYEQYLVDANSVPNEWRDYFDKLAQSPGAAERDVPHLPI
QESFIQLAKKPVIGQRGAAATDWAAMQKQVGVLKLISAYRVLGARQANLDPLRRMDQAIV
RELDPATHGLNDADMAVQFNVGSLAGPQKLPLSDIIARLKQTYCGNIGVEFMHITQSDEK
HWVQKRFEEALSTPRYDAGKKQRILKQITAAETLERYLHTKYVGQKRFSLEGGESAIAAL
DHLIQNATEQGVQELIIGMAHRGRLNVLVNTLGKLPRDLFAEFEGKAAQQMASGDVKYHM
GFSSDIPTASGPMHVSLAFNPSHLEIVNPVVEGSVRARQDRRKDAERKTAVPVLIHGDSA
FGGLGVNQGTFNLSQTRGYGTGGTIHIVINNQVGFTTSDTRDIRSTMYCTDVAKMIEAPI
LHVNGDDPEAVCFVMQAALDYRMTFKKDVVIDLVCYRKLGHNEGDDPFLTQPMMYKKIAK
HQGVRAMYAERLVQEGVLKAEEADAQIQAYRDALDKGEHVEQTALTNYRREHALDFSQYL
GTHWAHPTDTSLPQADIQRLTDKFTTLPEGFKLHPTVQKVLAARKAMAAGEQNVDWGMAE
TLAYASLVTNGFGVRLSGEDSGRGTFSHRHSVLHDQNRESWDQGSYVPLRNMSDNQADFL
VIDSILNEEAVLAYEYGYACSAPDQLVIWEAQFGDFANGAQVAIDQFISSGETKWGRLCG
LTTILPHGYDGQGPEHSSARLERWLQLCAEHNMQVVMPSEAGQMFHMLRRQVLRPYRKPL
VIFLSKRLLRFKDSMSPVEDLTSGSFRPVIGDVVVKDPKKVKRVLLCAGQVYYDLAAARK
ERSLDDDIAIVRIEQLYPFPTEQVAAELARFTQAKEVMWVQEEPRNQGAWYQIRHRLEGL
LTAKQQLSFAGRPSSASPAVGYMSKHVAQLKAFVEEAMSVAR
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaatccatgtacagccattcctatctgttcggtgggaatgccccgttcatcgag
gagctgtacgaacagtacctcgttgacgccaactcggttccgaacgagtggcgcgactac
ttcgacaagctggcgcagtcgccgggcgccgccgagcgcgacgtgccgcacttgccgatc
caggagtcgttcatccagctggcgaagaagccggtgatcggccagcgcggcgccgccgcc
accgattgggcggcgatgcagaagcaggtgggcgtgctcaagctgatctccgcctaccgc
gtgctgggcgcgcgccaggccaacctggacccgctgcgccggatggaccaggccatcgtg
cgcgagctggacccggctacccacggtctgaacgacgccgatatggcggtgcagttcaac
gtcggctcgctggccggcccgcagaagttgccgctgtccgacatcatcgcccgtctgaag
cagacctactgcggcaatatcggcgtcgaattcatgcacatcacccagtccgacgagaag
cactgggtgcagaaacgcttcgaggaggcgctgtccactccgcgctacgacgcgggcaag
aagcagcgcatcctgaagcagatcaccgccgccgaaacgctggaacgctacctgcacacc
aagtacgtcggccagaagcgcttctcgctggaaggcggcgagtccgccatcgcggcgctg
gaccacctgatccagaacgccaccgagcagggcgtgcaggaattgatcatcggcatggcc
caccgcggccgtctgaacgtgctggtcaacaccctgggcaagctgccgcgcgacctgttc
gccgaattcgaaggcaaggccgctcagcagatggcctccggcgacgtgaagtaccacatg
ggcttctcgtccgacatcccgaccgccagcggcccgatgcacgtgtcgctcgcgttcaac
ccgtcgcacctggaaatcgtcaacccggtggtggaaggttcggtgcgcgcgcgccaggat
cgccgcaaggacgccgagcgcaagaccgcggttccggtgctgatccacggcgactccgcc
ttcggcggcctgggcgtcaaccagggcaccttcaacctgtcgcagacccgcggctacggc
accggcggcaccatccacatcgtcatcaacaaccaggtgggcttcaccacttcggacact
cgcgacatccgctcgacgatgtactgcaccgacgtggccaagatgatcgaagcgccgatc
ctgcacgtgaacggcgatgatccggaagccgtctgcttcgtgatgcaggccgcgctcgac
taccgcatgaccttcaagaaggatgtggtgatcgacctggtgtgctaccgcaagctcggc
cacaacgagggcgacgatcccttcctgacccagccgatgatgtacaagaagatcgccaag
caccagggcgtgcgcgcgatgtacgccgagcgcctggtgcaggagggcgtgctgaaggcc
gaggaggctgacgcgcagatccaggcctaccgcgacgcgctggacaagggcgagcacgtc
gagcagaccgcgctgaccaactaccgccgcgagcacgcgctggacttcagccagtacctg
ggcacccactgggcgcacccgaccgacacctcgctgccgcaggccgacatccagcgtctg
accgacaagttcaccacgctgccggaaggcttcaagctgcacccgaccgtgcagaaagtg
ctggccgcgcgcaaggcgatggccgccggcgagcagaacgtcgactggggcatggccgag
acgctggcctacgcgtcgctggtgaccaacggtttcggcgtgcgcctgtcgggcgaggac
tccggccgcggcaccttctcccatcgccactcggtgctgcacgaccagaaccgcgagagc
tgggaccagggcagctatgtgccgctgcgcaatatgtccgacaaccaggccgatttcctg
gtgatcgactccatcctgaacgaggaagcggtgctggcctacgaatacggctacgcctgt
tccgctccggaccagctggtgatctgggaagcccagttcggcgacttcgccaacggcgcc
caggtggccatcgaccagttcatctcttccggcgagaccaagtggggtcgtctgtgcggc
ctgaccaccatcctgccgcacggctacgacggccagggcccggagcactcctccgcccgc
ctggagcgctggctgcagctgtgcgccgagcacaatatgcaggtggtgatgccgtccgaa
gccggccagatgttccacatgctgcgccgccaggtgctgcgtccgtaccgcaagccgctg
gtgatcttcctgtccaagcgcctgctgcgcttcaaggattcgatgagcccggtcgaagac
ctgacttccggcagcttccgcccggtgatcggcgacgtggtggtcaaggatccgaagaag
gtcaagcgcgtgctgctgtgcgccggccaggtgtattacgacctcgccgcggcccgcaag
gagcgcagcctggacgacgacatcgccatcgtgcgcatcgagcagctgtacccgttcccg
accgagcaggtggccgccgagctggcgcgcttcacccaggccaaggaagtgatgtgggtg
caggaagagccgcgcaaccagggcgcctggtaccagatccgccaccgcctggagggtctg
ctgaccgccaagcagcagctgtcgttcgccggccgtccgtcgtcggcttcgccggcggtc
ggttatatgagcaagcacgtcgcccaactgaaggccttcgtcgaagaagcgatgtcggtc
gcccgctga

DBGET integrated database retrieval system