KEGG   Chromobacterium vaccinii: BKX93_20760Help
Entry
BKX93_20760       CDS       T04565                                 

Definition
(GenBank) hypothetical protein
Organism
cvc  Chromobacterium vaccinii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase MeaB T2SSE AAA_16 TsaE ATPase_2 MobB Viral_helicase1 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AOZ52194
UniProt: A0A1D9LLT9
LinkDB All DBs
Position
complement(4480234..4481445)
Genome map
AA seq 403 aa AA seqDB search
MNMLPVTVLSGFLGAGKTTLLNHILANREGKRVAVIVNDMSEVNIDARLVREGGAQLSRA
EEKLVEMSNGCICCTLREDLLLEIRRLAAEGRFDYLLIESTGISEPLPVAETFTFRDDDG
RSLADLARLDTMVTVVDACNFLRDYASRDSLTDRQASLGEEDERTVVDLLIEQVEFCDVI
VLNKTDLIRAEALAELEGILRSLNPRADIVRSEFGRVPLDRVLNTGRFDFDAAAEAPGWL
AELRGEHVPETEAYGISSFVYRARRPFHPQRLWQWMRQEWPGVVRSKGYFWLASRPQFAA
LWSQAGAVARHSCAGLWWAALERAEWPQDEDSLALIRSRWAEPFGDRQQELVLIGMDMDR
QALTAGFDACLLNDAELAGGMAAWDTLDDPFPRWEIREEEAEA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctgcctgtaacggtgctgtccggctttctcggcgccggcaagaccacgctg
ctgaaccacattctggccaaccgcgaaggcaagcgggtggcggtgatcgtcaacgacatg
tccgaagtcaatatcgacgcccgcctggtgcgcgaaggcggcgcccagttgtcgcgcgcc
gaggaaaagctggtggagatgagcaatggctgcatctgctgcacgctgcgcgaggatttg
ctgctggaaatccgccgcctggcggcggaaggccgcttcgactacctgctgatcgaatcc
accggcatctccgagccgctgccggtggcggaaaccttcactttccgcgacgacgatggc
cgcagcctggccgatctggcgcggctggacaccatggtgacggtggtggatgcctgcaat
ttcctgcgcgactacgcctcgcgcgacagcctcaccgaccgccaggccagcctgggcgag
gaagacgagcgcaccgtggtggatctgctgatcgaacaagtggagttctgcgacgtcatc
gtgctgaacaagaccgacctgatccgcgccgaagcgctggccgagctggagggcatcctg
cgctcgctgaacccgcgcgccgacatcgtgcgcagcgagttcggccgcgtgccgctggac
agggtgctaaacaccggccgcttcgacttcgacgccgcggccgaggcgccgggctggctg
gccgaactgcgcggcgagcatgtgccggaaaccgaggcctacggcataagcagcttcgtc
taccgcgcgcgccgtcccttccatccgcagcggctgtggcaatggatgcggcaggaatgg
cccggcgtggtgcgctccaaaggctatttctggctggccagccggccgcagttcgccgcc
ttgtggtcgcaggctggcgcggtggcccgccattcctgcgccggcttgtggtgggcggcg
ctggagcgcgcggaatggccccaggacgaagacagcctggcgctgatccgctcgcgctgg
gccgaaccgttcggcgaccgccagcaggagctggtgctgatcggcatggacatggaccgg
caggcgctgacggccggcttcgacgcctgtctgctgaacgatgccgaattggccggcggc
atggccgcctgggacacgctggatgatccgttcccgcgctgggaaatccgcgaggaagag
gccgaggcctga

DBGET integrated database retrieval system