KEGG   Cyprinodon variegatus (sheepshead minnow): 107081766Help
Entry
107081766         CDS       T06110                                 

Gene name
fancl
Definition
(RefSeq) E3 ubiquitin-protein ligase FANCL
  KO
K10606  E3 ubiquitin-protein ligase FANCL [EC:2.3.2.27]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
cvg04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107081766 (fancl)
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107081766 (fancl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cvg04121]
    107081766 (fancl)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107081766 (fancl)
Enzymes [BR:cvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107081766 (fancl)
Ubiquitin system [BR:cvg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107081766 (fancl)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107081766 (fancl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD-3 FANCL_C zf-RING_2 zf-rbx1 Tymo_45kd_70kd zf-HC5HC2H DUF2286 Prok-RING_1 RINGv
Motif
Other DBs
NCBI-GeneID: 107081766
NCBI-ProteinID: XP_015225489
Ensembl: ENSCVAG00000017100
UniProt: A0A3Q2D738
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MERLLIRDNPLLLPLNKEKTVYDGFITLQERDFRIRIILPPDLQLRKARLHCCWQLKHLL
REYEHIVKQRLLQSTDLNSFILELKTILEVALSRCPEGRSIPPPRYYSQLISEMEALGWD
KMLFIDMDFQTLKLGAEDSSGRQHVLTVKLKAKHPTEAPDCSADLPIPLAITWTPQSTLE
QLHSQFLLVLESLTDFWDVLDEIDRKTWVLEPEKPSRFDTMRRIAIGNNVSIKVEVDPRH
PKMLPECCLLGADHVVTPLRNKLNANMHMWNPDSSVLNNLRDVLEIEFPSPATHEKSSFN
MECGICYSYRLENAIPDQVCNDPRCGQPFHQACLYEWLRALPSSRQSFNLVFGECPYCSK
PITVKMAVQKS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagaggttattaataagagacaacccgctgcttttacctttaaacaaggagaaaacg
gtctacgacggatttataacccttcaggaaagagacttcaggattagaattattctccct
ccagacctccaactaaggaaagccaggctgcactgctgctggcagctaaaacacctgttg
cgtgaatatgagcacatagtgaagcagaggctgctgcagtcgaccgatctcaacagtttc
attctggagttgaagactatcctggaagtggctctaagccgatgtcccgagggtcgctcc
atcccgcctcctcgatattattcccagcttatctcagagatggaggctcttggatgggat
aagatgcttttcattgacatggacttccaaacactgaaactgggtgctgaggactcctct
ggcaggcagcacgttctcactgttaaactcaaagcaaagcatccaacagaggctcctgac
tgttcagctgacctcccgatccctttggccatcacctggacacctcagagtactctagag
cagctccacagccagttcctgctggttctggagtccctgacagacttctgggacgtcctg
gatgagatcgacagaaagacctgggttctagagccagaaaaacccagccgtttcgacaca
atgagacggattgccatagggaataacgtctccatcaaggtggaggtggatccgaggcac
ccgaagatgctaccagagtgctgcctgctgggagcagatcatgtggtgacgccgctgagg
aacaaactgaacgccaacatgcacatgtggaacccggactccagcgtcttgaacaacctc
cgggatgttttggagattgaattcccgtcaccggccacccacgaaaaatctagttttaat
atggagtgcggcatctgttactcctatcgacttgaaaatgccatcccagatcaagtgtgt
aatgacccccgatgtgggcagccattccaccaggcctgtctttatgagtggctacgagct
cttccctccagcaggcagagtttcaaccttgttttcggagagtgtccttattgcagcaag
cccattacagtgaaaatggcagtacagaagtcctga

DBGET integrated database retrieval system