KEGG   Cyprinodon variegatus (sheepshead minnow): 107083068Help
Entry
107083068         CDS       T06110                                 

Gene name
rmi2
Definition
(RefSeq) recQ-mediated genome instability protein 2
  KO
K15365  RecQ-mediated genome instability protein 2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107083068 (rmi2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107083068 (rmi2)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     107083068 (rmi2)
   FA (Fanconi anemia) pathway
     107083068 (rmi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RMI2
Motif
Other DBs
NCBI-GeneID: 107083068
NCBI-ProteinID: XP_015227497
Ensembl: ENSCVAG00000016220
UniProt: A0A3Q2D517
LinkDB All DBs
Position
Unknown
AA seq 146 aa AA seqDB search
MSKLEQSHCDGKRPPPVKVLSGQLRAAGIRGAADSGEGYLIRAGKGRTLRVSLVWMQGTV
LEVQLDSNTVLLMDETGTFMVQGVNSIPKGKPCLLPGKYVMVMGVIQAVAPEPVIRAVKM
ADLSEFAALHRKMWKLEVEELQQILA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactggagcaaagccactgtgatggaaaacgtcccccgccggttaaagtcctg
tccggtcagctaagagcggcggggatccggggggccgctgacagcggggagggatacctg
atcagagcgggcaagggtcgcactctgcgggtgtctctcgtgtggatgcagggcaccgtg
ctggaggtccagctggacagtaacacggttctgctgatggatgagacggggaccttcatg
gtccagggcgttaacagcatccccaaagggaaaccatgtttgctcccaggtaaatatgta
atggtgatgggcgtcatccaggccgttgccccggagccagttatccgcgctgtgaagatg
gcagacctctcagagtttgctgcactccacaggaaaatgtggaagttggaggtggaggag
ctgcagcagatactggcatga

DBGET integrated database retrieval system