KEGG   Cyprinodon variegatus (sheepshead minnow): 107083143Help
Entry
107083143         CDS       T06110                                 

Gene name
stra13
Definition
(RefSeq) centromere protein X
  KO
K15360  centromere protein X
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107083143 (stra13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107083143 (stra13)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     107083143 (stra13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-X CBFD_NFYB_HMF DUF4630
Motif
Other DBs
NCBI-GeneID: 107083143
NCBI-ProteinID: XP_015227627
LinkDB All DBs
Position
Unknown
AA seq 81 aa AA seqDB search
MADKEEEVSFKKQTVTKLLCSFFKEDKTKLSSDATLLMMDMLRIFVQEAALRSLKQAESE
DCNQVELEHFEKILPQLLLDF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaagaggaagaagtcagctttaaaaagcaaacagtgaccaaactcctgtgc
agtttctttaaagaggacaaaaccaaactaagtagtgatgctacactgctcatgatggat
atgctgagaatatttgtgcaagaggctgctttgagatcgcttaaacaggccgaatctgag
gactgcaaccaagtggagcttgagcattttgaaaagatcctgccacagctgcttctggat
ttctag

KEGG   Cyprinodon variegatus (sheepshead minnow): 107089341Help
Entry
107089341         CDS       T06110                                 

Definition
(RefSeq) centromere protein S-like
  KO
K11511  centromere protein S
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107089341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cvg03036]
    107089341
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107089341
Chromosome and associated proteins [BR:cvg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     107089341
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     107089341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-S CENP-T_C Histone Serine_rich DUF1043 TniQ
Motif
Other DBs
NCBI-GeneID: 107089341
NCBI-ProteinID: XP_015237560
Ensembl: ENSCVAG00000006166
UniProt: A0A3Q2GCY8
LinkDB All DBs
Position
Unknown
AA seq 121 aa AA seqDB search
MSEKEDTHQRLKAAVHYTVGRLCQRVAEEHRREFSRQAVAAIAETTFRECDIFAKDLEAF
ARHAKRTTVSAEDVKLLARRSTALSRHIQNKSEELAQEQKDTRKKNTGKRKSRDTEEESK
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaagaagacactcaccagaggctgaaggcagcggttcattacacggtaggt
cgtttatgtcagagggtcgcagaggagcaccggagggagttcagccggcaggccgtggca
gccatagcagagaccacattcagagagtgcgatatatttgccaaagatctagaagctttt
gcaagacatgctaaaagaactacggtgtctgcagaggatgtgaagcttctagctcgtcgc
agtactgctctgtccagacacatacaaaataaaagtgaagaattggcccaggagcagaaa
gataccagaaagaagaatacagggaagaggaagagcagagacacagaggaggaaagtaaa
gaatga

DBGET integrated database retrieval system