KEGG   Cyprinodon variegatus (sheepshead minnow): 107083205
Entry
107083205         CDS       T06110                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107083205 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107083205 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cvg04052]
    107083205 (kitlg)
Cytokines and growth factors [BR:cvg04052]
 Growth factors
  Growth factors (RTK binding)
   107083205 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107083205
NCBI-ProteinID: XP_015227707
Ensembl: ENSCVAG00000008551
UniProt: A0A3Q2CNK5
LinkDB
Position
Unknown
AA seq 271 aa
MKKSKSWIHTCVHFLLFMTLGVHSATLDVQRMTDDIDRELPVLRHNIPKDYNISLQYIPK
EMGKTCWVKLNLVYLNQSLKDLSNKFGNSSSNKELIKLIMLYVEEERRKIQKQFTDLKWE
DLMWEFQCHSRQQMWETGKYFDFVKEFFRAAKNEDYSDDCSDPECPVDPTKEYSTGQPLE
SQNIGNESWQAPPFTVEPPSPIVKIIEKSLFSLLFIPLLALIFLLVWKVRSKRNVDPPQP
NRGEEDPITSPEERTPPLDGERNVLHIFAKV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacacacctgtgtccatttcctgctgttcatgacactt
ggggtacattcagctacacttgatgttcaaagaatgaccgatgacattgacagagaactc
cctgttttgagacacaatattccgaaagactacaacatttctttacagtatattcccaaa
gaaatgggtaagacgtgttgggtaaaattaaaccttgtttacttgaaccagagtttaaaa
gatttatccaacaagtttggaaacagttcatctaataaagagctaataaaattaatcatg
ctttacgttgaagaagaacggcgaaagatccaaaaacaatttactgatctaaaatgggaa
gaccttatgtgggaatttcagtgccactccagacaacagatgtgggaaacaggaaaatac
tttgactttgtcaaagagttctttagagctgcaaagaatgaagactattcagatgattgt
tcagatcctgaatgtcccgttgacccaacaaaagaatattcaacaggtcaaccactggag
tcacaaaatatcgggaatgagtcatggcaggcgccaccattcacagttgaaccgccaagt
cccattgtcaagataattgagaaaagccttttctccttactgtttataccactgctggca
ctaatcttcctcctcgtttggaaggtcagatcaaaaaggaacgtagatcctcctcagcca
aaccgtggagaagaagacccaattacatcaccagaagagaggacacctccgctagatggt
gaaagaaatgtactccacatttttgcaaaagtgtaa

DBGET integrated database retrieval system