KEGG   Cyprinodon variegatus (sheepshead minnow): 107083549Help
Entry
107083549         CDS       T06110                                 

Definition
(RefSeq) B-cell lymphoma 3 protein-like
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5 DUF3447
Motif
Other DBs
NCBI-GeneID: 107083549
NCBI-ProteinID: XP_015228354
Ensembl: ENSCVAG00000015157
UniProt: A0A3Q2D339
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MPSPMTMSVDHQSVATAPLDLSTTGRGRRSGGDLTFCDGDARASGGSPAPPASTGTDSSV
LHRSPDTDSTHSRKRTADGSPIKSPSTLPFRKRHFLVEAEAQKPAPPAAAAEEQTVREPA
RPRLGKAEDETRFGVAPVTHRRTDQAAHSPEGYPCCILPLINYGHYPVCCLTPFPEPHHP
QVHQTDNLLAGISLAKHQDEDGDTPLHIAVVQGELPIVHKLIQLLLLARTGLDIYNNLRQ
TPLHLAVITKQANIVEVLLRAGADPAVLDRHGQTALHLCCEYQQLDCLSVLLSLSSSSPC
LEIRNFEGLSPLHLAVLQGHHDLTKMLLDAGADINAMDIKSGQSPLIHAVESNNADMVHF
LIENGCDVNSQSYSGNTALHIACGRGQVDTVRLLLKSGADSSLKNYHNDTPVMVAKNKKI
TDVLRGRGSKIRFQEQPCASMSPHQSCYMENGSPSSNHSRGSSPLMTPHSLNPSASHSLK
TSSALY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtcctatgacaatgagcgttgaccaccagtcggttgctacagcgccgctggat
ctgagcaccacaggtcgagggcgcaggagcgggggagacctaaccttctgcgacggagac
gcgcgggcgagcggcggctcacctgcgcctcccgcgagcaccgggacggacagttcagtg
ttgcaccgctccccggacacggacagcacccattcccgcaaaaggacagcggacggatct
cccataaagagtccgtcgactcttccttttaggaaacggcattttcttgtcgaagcggag
gcgcagaagccggctccaccggctgcagctgcagaggagcagacagtccgggagcccgcg
cgtcctcgcttggggaaagctgaggatgaaaccaggttcggggttgcgccggtgacccac
aggcggaccgatcaggcagctcacagtccggaaggctatccctgctgcattttaccactt
attaattacggtcactacccagtgtgctgcctaaccccctttccagagccacaccaccca
caagtccaccagaccgacaacctgctggcaggaatctctttggccaaacatcaggatgaa
gatggagacactcctctccatatagctgtggttcaaggggaattgccaatagtccacaaa
cttatccaactgctgctgttggctcgtacaggccttgatatttacaacaatctccgacag
acccctcttcatctggcggtgataaccaagcaagcaaacatagtcgaggttttattgaga
gctggggccgaccctgcagtcttggaccgccatggccaaacagcactccatctctgctgt
gaatatcagcagcttgactgcctgtctgtactgctgtctttgtcgtcgtcctccccatgc
ctggagatcaggaattttgaaggtctcagtccacttcatttggctgtgctgcaaggccat
catgatttgaccaaaatgctgctggatgcaggagctgatatcaatgcaatggacattaag
agtggccagagtcctctcatacatgctgtggaaagcaataatgcagatatggtgcacttc
cttattgagaatggatgtgacgttaacagccagtcctacagcgggaacacagccctccac
atcgcatgtggccgaggtcaggtggacacagtccggctgctgttgaagagtggagccgac
agcagcctaaagaactaccacaatgatacaccagtaatggtggccaagaataaaaaaata
acagatgtgttacgaggaagaggctccaagatcagatttcaggagcagccctgtgcgtcg
atgtcgccacatcagagttgctacatggaaaacggatccccttcttcaaaccacagtcga
ggatcttcacctctgatgacgccacacagcctcaatcccagtgcttcccattccctaaag
acctcatctgcactctactag

DBGET integrated database retrieval system