KEGG   Cyprinodon variegatus (sheepshead minnow): 107083681Help
Entry
107083681         CDS       T06110                                 

Gene name
fancg
Definition
(RefSeq) Fanconi anemia group G protein isoform X1
  KO
K10894  fanconi anemia group G protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107083681 (fancg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107083681 (fancg)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107083681 (fancg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_12 TPR_7
Motif
Other DBs
NCBI-GeneID: 107083681
NCBI-ProteinID: XP_015228568
Ensembl: ENSCVAG00000011891
LinkDB All DBs
Position
Unknown
AA seq 610 aa AA seqDB search
MIQPLCLLDRWTQENNELASSYKQDGQDAQNRDHNLFRQRRYSSDFHKLLKKIQGIPPHL
DHAQLELSVAYNTCVCFTAQSQFEDAQMLLTQTIQRVLEIAGENPGTPDPSVLWKAALIS
VASTALHRSVLGLFCLQWGTWLAKRCWTAIKEFQAKISLFDEQRQGVWDEKIPNFPRLVV
EPRRLSELLKICSAISQGAERLDEGWSTLSSLQAASALPAPRALIAYTHLLSGSCLAHMS
RPQMALQCFRKALETDPCCVCALYQSILIYRQLGNSQAEIQALRILHSTLLLPSTTEQAM
AGSQLLSPSLFLCSKSLSSLLSVPSALSVLHCLALKCVIHGRVSEGVEYYLDLLAALHSE
DQHGPPAAVSILPKLPRLYLEAGAALLMARRPADCLTLCDEVSRTIVDLLPEKVIVDDPE
EGSVSWSREGKDETESGLERLLWAAASYLLQGHCYCQLMEWKQAVTNYTRCINLVVKVHY
KRRSISPQIPSTDIDAEQAGDLLVLQRLKGLSLAGRGISFAQMSQLREALRDLQLSLQAH
PEGVTAGQWCGEVLWRLDRKQEAAAYWKKTWSQPIPSIAETLPVYAQELQSDLLLDSEEL
HQRLQELDPI
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaccactctgtttattggatagatggactcaggaaaataacgagttggcttct
agctataagcaggatggacaggatgctcagaatcgagatcacaacctgttcagacagaga
cgatattcctctgattttcacaaacttctaaagaaaattcaaggcatccctcctcatctg
gatcacgcacagctggagctttcagtagcctacaacacctgtgtgtgctttactgctcag
tctcagtttgaggatgcacagatgctcctcacacagaccatacagagagtgcttgagata
gccggagagaatccaggtacccctgacccttctgtgctttggaaggcagctcttatatca
gtggccagcacagctttgcatcgctccgtattaggcctgttctgtttgcagtggggaaca
tggctggctaaaagatgctggactgcaattaaagaatttcaggcaaagatttctctgttt
gacgaacaaagacaaggagtttgggatgaaaagatccccaattttccaagactggttgtg
gagccaagaaggctttctgagcttttgaagatctgctctgcaattagccaaggtgcagaa
aggctggatgaaggttggagtaccctttcatctctgcaggctgcctctgccttgcctgct
cccagagctctcatagcatacacacacctcctctcaggttcctgcctcgcccatatgagc
cgccctcagatggcactgcagtgtttcagaaaggctctggagacagatccctgttgtgta
tgtgctctctaccagagcatactcatctacaggcagctgggaaactcacaggctgagatc
caggctcttcgtattctgcactcgactttgttgttaccctcgacaacagaacaagcaatg
gctgggagccagctcctctcaccgtccttgtttctctgcagcaagtcactgagcagcctg
ctctcagtcccgtctgccctcagtgtccttcactgtttggctcttaaatgtgttatccat
ggcagagtgtcggaaggtgtggagtattatttggacttgctcgctgctcttcattcagaa
gatcaacatggaccgcctgctgcagtctctatcctccccaagttacccaggctctacctt
gaggctggggctgcattactcatggccagacgacctgcagactgtctgacgctttgtgat
gaggtcagcaggacaattgtggatctgctccctgagaaagttattgtggatgatccagag
gaaggaagtgtgtcttggagcagggaggggaaagacgagactgagagcggattggagagg
ctgctctgggctgcagcatcctacctcctccagggtcactgctactgtcagctgatggaa
tggaagcaagcagttaccaactacactaggtgtattaacctggttgtgaaggtgcactat
aaaaggagaagcatctcaccacaaattcccagtacagatattgatgctgagcaggctgga
gatttacttgtcctccaaagactaaaggggctttcattggctggtaggggcatcagcttt
gctcagatgagccagctgagggaggccctcagagaccttcagctcagtctgcaggcccac
ccagaaggtgtgactgcagggcagtggtgtggggaggtgctgtggaggctggacaggaag
caagaggcagctgcatattggaaaaagacctggagccagcccattccatccatagcagag
actcttcctgtttacgcacaagaacttcagtctgatctgttgctggattcagaggagctg
catcaaagactgcaagaacttgaccctatctag

DBGET integrated database retrieval system