KEGG   Cyprinodon variegatus (sheepshead minnow): 107084110
Entry
107084110         CDS       T06110                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107084110 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cvg04052]
    107084110 (epo)
Cytokines and growth factors [BR:cvg04052]
 Cytokines
  CSF and other factors
   107084110 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107084110
NCBI-ProteinID: XP_015229277
Ensembl: ENSCVAG00000016783
LinkDB
Position
Unknown
AA seq 185 aa
MLRKTFRGLFALLLLVLEWTRPGLLSPLRPICDLRFLNHFIQEARDAEVAMKSCREGCDL
SESVSVPKTSVNFDEWEKKDATEQAQEVQSGLWLLQQALNLLRTSMTNSDLTSHIDTTVG
NLQSITNVLRSLNFQEYTPPASTVGMEGTWTVSSAAELLQVHHNFLRGKVHLLLKDAQPC
KQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacttttagaggactgttcgccttgctgctgttagtgttggagtggacc
cgtccaggcctgctgtccccactaaggccaatctgtgacctgagattcttgaaccacttc
attcaggaagcacgagacgccgaagtcgctatgaagtcatgcagagaaggatgtgatttg
tcagagtctgtctctgttcccaaaactagtgtcaactttgatgaatgggagaagaaagac
gcaacggagcaagctcaggaagtgcagagtggattgtggcttttacaacaagccctcaac
ttactacggacatcgatgacaaactctgaccttaccagccatatagacactaccgttgga
aatctgcaaagcatcactaatgtactacgaagcctcaactttcaagaatataccccacct
gccagtactgtgggaatggagggaacatggacggtgtcctcagcagcagaactgcttcaa
gttcaccacaatttcctgcgaggcaaagtacaccttctccttaaggatgcacagccatgc
aagcaagacgtcagctga

DBGET integrated database retrieval system