KEGG   Cyprinodon variegatus (sheepshead minnow): 107084986Help
Entry
107084986         CDS       T06110                                 

Gene name
telo2
Definition
(RefSeq) telomere length regulation protein TEL2 homolog
  KO
K11137  telomere length regulation protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
cvg04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107084986 (telo2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    107084986 (telo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cvg03032]
    107084986 (telo2)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107084986 (telo2)
DNA replication proteins [BR:cvg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107084986 (telo2)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107084986 (telo2)
  Check point factors
   Triple T complex
    107084986 (telo2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Telomere_reg-2
Motif
Other DBs
NCBI-GeneID: 107084986
NCBI-ProteinID: XP_015230560
Ensembl: ENSCVAG00000001665
UniProt: A0A3Q2C7U6
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MEFGSTHSEVRLKVAQCFRTLSTSTDNKDVTEALKTLNSFLDDGAESGTTSAEREEFRRA
HYSRTLRVLVGHLQADWMHALSPTQRSQLWDPLFLRGPPDQTLLVLMEAVTQLSSSSGLE
RLVSITERFLQSGRLADLLWSFCLHSAPSASPQLRETLLARLTALPDITANKLHPNNRPI
FAPQRYYPLLASEMLAALERTCQALRGGTDCSLTFVAQTLGKVCIQGHSGPVLAAMFPRL
ALCTRSDMVWQRVCWKLLENVPERWMESVLTGLIQAAKSPDAFSRVVGNLVLTNKKAHFV
LTHKVLLLQYKYETQVLKTVLGYLASDRERRPLLIQVLQSVSQAWANPSAVKHTPLEQQL
YVSKALLLTASLLKDSELQELRSDLLQCMLGGMQSHLDSSVVRIRTMGMVVGECLSSRMD
INGTKLKFEYEQDEETRELLSLMTPSSEPESDPEPADGAPHAEEIREPSDPTAASGSTPA
SPRSKTDPDSDLDSDDDLTPYDMSGDQAMSQASPPRYLRDCLETLISSEDSERVELSLRA
AAGLVRRNIFAAKEISVQMTKVLLHMEDKYSINGFLALRQAAMVALTVIDAIPVTQYLTT
EFYSLNYSLRQRMDILEVLALAAQELSKPVADKVTGAATTSELTSYRSSDPADWRQVVEK
RIQSKTKRISKGSAQPVSKAAPNRYAPVAGYFFFPLLKNYDRPEVTFDLLGSDQLVLGRL
IHTLGLFMHLALNAPIAAQMGAALLDFVWAVRYHVDQMVRRGVLFAVCSVFLSMPSQSLL
VDLGEQLFETRTWLADVAEGDPDADCRNLALQSLVLLDKSLKKQLQDPKALSLES
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggagttcggatcgacccattcggaggttcggctgaaggtggcccagtgtttcaggacg
ctttccacctccacggataataaagatgttactgaagcgttgaaaacgctgaactccttt
ctagatgatggagccgaaagcggcaccacctcagccgagcgggaggagttccggagggcc
cattacagccgaaccctccgggttctggtgggccacctccaggctgactggatgcacgct
ctctcccccacgcagcgctcacagctgtgggaccctctgttccttagaggccccccagac
cagacgctgctggtgctgatggaggcggtgactcagctcagctccagtagcggtttggag
cgcctcgtcagcatcactgagcggttcctgcagagcggtcgcctggccgacctgttgtgg
tccttctgtcttcattcagcaccctcagcctcacctcagctcagggaaaccctgctagct
cgtttaacggcgctgccagatatcaccgccaacaagttacaccccaacaacagacccata
ttcgctcctcagcggtactacccgctcctggcctcagagatgctcgctgctctggagaga
acctgccaggccctcagaggtggcacagactgctctttaacatttgtagctcagacactt
gggaaagtttgtatccaagggcacagtggccctgtcctagcagcgatgttccctcggctg
gctctctgcacgcgctcagacatggtgtggcagagggtgtgctggaagctgctggagaac
gttcccgagcgatggatggagagcgtgctcactgggctgattcaggctgccaaaagccct
gatgccttcagtcgtgtcgttggaaatctagtgctaacaaataaaaaggctcattttgtg
ctgactcataaagtgctgttactgcagtataagtatgagactcaggtcctgaaaacggtt
cttggttacctcgcctcagacagggagcgacggccgctgctcatccaggttttacagtct
gtgtcgcaggcctgggcaaaccccagtgcagtaaaacacacacctctagagcagcagctc
tacgtcagtaaggccctcctgctgaccgcgagtctgctgaaggactccgagctgcaagag
ctgcgttcagatttgctccagtgcatgcttggtggcatgcagagccatttggacagcagc
gtggtgcgcatcagaaccatgggcatggtggtgggggagtgcctgagctctcggatggat
atcaacggcaccaagctcaaattcgagtatgagcaggatgaagaaacccgtgagctgctg
tctctcatgacccccagcagtgagccggagtctgatccagagcctgcagatggagccccc
catgctgaggagatcagagaaccatccgatcctactgcggcgtcaggaagcacaccagca
tcaccgcgatcaaagactgatccagactcagatcttgatagcgatgatgacctgactcca
tatgacatgtctggagaccaggcgatgagtcaggcgtctccacctcgttacctgcgggac
tgtctggaaactctgatatcttctgaggactcggagcgagtggagctcagtttgagagct
gcagctggtttggtgcggaggaacatctttgcagcgaaggagatcagcgtccagatgacc
aaagtgcttttgcacatggaggataaatacagcattaatggcttcctggctctacggcag
gcagcaatggtggctctcactgtcatcgacgccattcctgtgactcagtacctgactaca
gagttttactccttaaactacagcctccggcagcgaatggacatcttagaggtgttggcc
ttggcagctcaggagctctctaagccggttgctgataaagtaaccggtgctgctactacc
tcagagctgacatcgtaccgttccagcgatcccgccgactggagacaggtggtggaaaag
aggatccaaagcaagacgaaacgcatctctaagggttccgcccagcctgtatctaaagct
gctccaaaccgttatgctcctgttgctggatacttcttttttcctctgctgaaaaattac
gacaggccggaggtgacctttgacctgttgggcagtgaccagctggttcttggccgcttg
attcacactctgggcctcttcatgcacctggctctcaatgcaccgattgctgcacagatg
ggcgctgcattgctggactttgtgtgggcagttcggtaccatgttgaccagatggtgagg
cgaggagtcctcttcgccgtctgctccgtgttcctgagcatgcccagtcaaagtctgctg
gtggacctcggcgaacagctgtttgaaaccaggacttggctggcagatgtggcggaagga
gacccggacgcagactgccgcaatttagccctgcagagcctggttctgcttgacaagagc
ctcaagaaacagctacaggatccaaaggccctgagcctagaatcctga

DBGET integrated database retrieval system