KEGG   Cyprinodon variegatus (sheepshead minnow): 107085111Help
Entry
107085111         CDS       T06110                                 

Gene name
rpa2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03030  DNA replication
cvg03420  Nucleotide excision repair
cvg03430  Mismatch repair
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107085111 (rpa2)
   03420 Nucleotide excision repair
    107085111 (rpa2)
   03430 Mismatch repair
    107085111 (rpa2)
   03440 Homologous recombination
    107085111 (rpa2)
   03460 Fanconi anemia pathway
    107085111 (rpa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cvg03032]
    107085111 (rpa2)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107085111 (rpa2)
DNA replication proteins [BR:cvg03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107085111 (rpa2)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107085111 (rpa2)
   MMR (mismatch excision repair)
     107085111 (rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107085111 (rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon TFA2_Winged_2 RMI2
Motif
Other DBs
NCBI-GeneID: 107085111
NCBI-ProteinID: XP_015230755
Ensembl: ENSCVAG00000017246
UniProt: A0A3Q2D7C8
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MWNQGGYTDSAMVGGYTQSPGGFASPALSQGGEKKGRTRATQIIPCTVSQLMSASQTEET
FRVGEVEVTQVTIVGIIRSTDKSMTNIQYKVDDMTGAPMDVKQWVDTEDPSVDSTVLPPG
TYVKVSGNLRSFQNHRSIVAFSVRPLEDMNEITSHILEVVHAHMALSKPQTVPGIGGGMG
ANSTPMLHQGPGMTGGSYEGANESPLMVINGLNANQNQVLSLIKGCPDPQGISIQDLKQR
LSGISLAVIKQAVEFLSNEGHIFSTIDEDHYKSTDNDD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatcaggggggatacactgactctgcgatggtcgggggttatactcaatctcct
ggaggttttgcatccccagcattgtcccagggaggagagaagaaagggaggacccgtgct
acacaaatcatcccctgcactgtgtcccagctgatgtctgcctctcagacagaagagacc
ttcagagtgggagaagtggaagtgacgcaggtcaccattgtgggcatcataagaagcaca
gataaatctatgaccaacatccagtacaaggtggacgacatgacaggtgctcctatggac
gtgaagcagtgggtagacaccgaggaccctagtgttgacagcactgtgttgcccccagga
acatatgtcaaagtgtcaggaaatctgcgctcctttcagaaccacagatctattgtagca
ttcagtgtcaggccgctggaggacatgaatgaaatcacctcacacattcttgaggttgtc
catgctcacatggcgctcagcaaacctcaaactgtgccaggtatcggtggaggaatgggg
gccaacagtacaccaatgcttcaccaaggcccggggatgaccggagggagctacgaaggt
gccaatgagagcccactaatggtcatcaatgggttaaatgcaaatcagaaccaggtgttg
agtttgataaaaggctgtccggacccacaaggcatcagcattcaggatctgaagcaaaga
ctcagtggcataagtcttgctgtaatcaagcaagcagtggaattcctgagtaacgaaggc
cacatcttttcgaccatagacgaagatcactacaaatcaacagacaatgatgactaa

KEGG   Cyprinodon variegatus (sheepshead minnow): 107088102Help
Entry
107088102         CDS       T06110                                 

Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit-like
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03030  DNA replication
cvg03420  Nucleotide excision repair
cvg03430  Mismatch repair
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107088102
   03420 Nucleotide excision repair
    107088102
   03430 Mismatch repair
    107088102
   03440 Homologous recombination
    107088102
   03460 Fanconi anemia pathway
    107088102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon CDC24_OB3 DUF5088 zf-C2H2_6 IBR
Motif
Other DBs
NCBI-GeneID: 107088102
NCBI-ProteinID: XP_015235534
Ensembl: ENSCVAG00000013446
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MPIKLTQGAVKALYNGTPVHNPVLQLMNIRRLTSSDSPRYRLAMSDGQHFLSAFLLATQL
NHLAEEDLLVPNCVCLLKRTTTNTLSDGRQVVVVVEMEVLKSAEETGGKIGNPKPYSTDG
KQASPHMVSSNTSEPASTSAAELPGPSGTNSNNSRGWGKKFTGKAPMTASPMKTSPMEES
PMKTSPMKGSPMKTFPMKESPMKTSPMKGSPMKTSPMKGSPMKVSPMKATTSSPSAIPKV
IPISNLNPYISKWTIRARVTNKSNIRNWSNSRGEGKLFSFEIVDESGEIKITAFNNEVDK
FFSLVEQGKVYYISKATLKIANKQYTTLKNDYEMTLHAHSSIVPCEDTHDIPSMQCDFVP
IGDLENRDKDAIIDIIGVCKSAEDVSRITTKNSREVSKRAINLIDTTGKVVTVTLWGEEA
EKFDGSGQPVVAIKGARLSDFGGRSLSALFSSTVMVNPDLPEAFRLRVWYDKEGYAVDSQ
SLTETMSVSIGPKMNWKTLSDVKNENMGHGEKAEYFSCVATVVYMRKENCLYQACPSADC
NKKVIDQQNGFYRCEKCNREFPSYKYRLLLSANLADFGDNQWVTCFQETAEVLLGRKAEE
LGQLRETDEAEFDEVFQKANFKTHIFKNRVKLETYNDESRVKVTVMEVLPVDHREYSRRL
ISNIQKLAC
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaactaacacaaggggcagttaaagccctctacaatggaaccccagtgcac
aatccagtactacaattaatgaacatccgtaggctcacttcctcagattcacctaggtac
cgtcttgcaatgagtgatggtcagcatttcctgtctgcgttcctgctggctacccagtta
aaccatctagcagaagaagaccttcttgtccccaattgtgtttgcttgttgaagaggaca
accaccaacactttgtcagatggccggcaggtggtggttgttgtcgaaatggaggttttg
aaatcagctgaggaaactggtggaaagattggaaatcctaaaccatattcaacagatggt
aagcaggcctctccacatatggtgtcgtcaaacacctctgaaccagcttccacttcagct
gctgaattacctggaccctccggcacaaatagcaacaacagcagaggctggggaaaaaaa
tttacaggaaaagcccccatgactgcgtcacctatgaagacttctcccatggaagagtca
cccatgaagacctcccccatgaaagggtcacccatgaagaccttccccatgaaagagtca
cctatgaagacctcccctatgaaagggtcacccatgaagacctcccccatgaaagggtca
cccatgaaggtctctccaatgaaggccactaccagttcacctagcgctatcccaaaagtg
atccccatttctaacctcaatccatacattagcaagtggaccatcagagccagagtcaca
aacaaatccaatatccgtaactggagtaattccagaggagagggaaagctcttctccttt
gagatagtagatgagagtggtgaaatcaagattacagccttcaacaacgaagtggacaag
tttttctctctagtggagcaaggcaaggtgtactacatctcaaaggctactctaaagata
gccaacaaacagtacaccactctgaagaacgactatgagatgacccttcatgctcattca
tctattgtgccttgtgaggacacccacgatatcccatcaatgcagtgtgactttgtgcct
attggagacttggaaaacagagacaaagatgccattattgatataattggagtgtgcaag
agtgcagaggatgtatcccgtatcaccacaaagaacagcagagaagtctccaagagggcc
atcaacctaatagacaccaccggtaaagtggtgacagtcactctgtggggggaggaggcg
gagaagtttgacggctcaggacagcctgttgttgccatcaaaggagctcgcttgtctgat
tttggaggcagatctctctcagctttgttcagttcaacagtcatggtcaacccagattta
cccgaagccttcagacttagggtctggtatgacaaggaaggttatgcagtcgacagccag
tcgttaacagaaaccatgtcagtcagcattggaccaaagatgaattggaaaacgctgagc
gatgttaagaatgaaaacatgggacacggcgagaaggcggagtatttcagctgtgtggcg
acagtagtgtacatgcgtaaagagaattgcttgtatcaggcatgtccgtctgcagactgc
aacaagaaggtgatagaccaacagaacggtttttaccgctgcgaaaagtgtaacagagag
ttccctagctacaaatatagactcctactttcggctaacttggcagacttcggggataac
cagtgggtgacatgcttccaggagacagctgaggtcctgctgggtcgcaaggcagaggag
ctgggacagctcagagaaacagacgaggctgagttcgatgaagtcttccagaaagccaac
ttcaaaacacacatctttaaaaaccgagtcaaattggagacgtataacgatgagagtcgg
gtgaaagtcaccgtgatggaggtgcttcctgtcgaccacagagaatacagcaggagactg
atcagtaacatccagaaattggcttgctga

KEGG   Cyprinodon variegatus (sheepshead minnow): 107090245Help
Entry
107090245         CDS       T06110                                 

Gene name
rpa1
Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03030  DNA replication
cvg03420  Nucleotide excision repair
cvg03430  Mismatch repair
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107090245 (rpa1)
   03420 Nucleotide excision repair
    107090245 (rpa1)
   03430 Mismatch repair
    107090245 (rpa1)
   03440 Homologous recombination
    107090245 (rpa1)
   03460 Fanconi anemia pathway
    107090245 (rpa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon Pox_vIL-18BP P_C IBR
Motif
Other DBs
NCBI-GeneID: 107090245
NCBI-ProteinID: XP_015239008
Ensembl: ENSCVAG00000019431
UniProt: A0A3Q2DCD2
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MANLSAGAIEALANGSGWNEAVLQLVNIRRLDGGNGPARFRVMMSDGRHTLSSFMLSTQL
NYMAEENILVPNCVCLLKRQVTNMLKDGRRVVIILEIQVLKPAEEVGGKIGDPTPYSDGQ
SKGQQPAPAPAPAPVPETRQPLQQQNRNEVNRNLNRDFMKKVPSALPDTPGGGSKVVPIA
SLNPYQSKWTIRARVTNKSSIRTWSNARGEGKLFSMEMVDESGEIRVTGFNQEVDKFFSL
IEVGKVYYVSRGSLKIANKQYTSVKNDYEMTLNGESTVIPCEDSCDVPMVQCDFVSIGDL
ENREKDAIVDVIGVCRSVDEVTKLTTKSNREVSKRTLSLMDMSGKLVNVTLWGEEAEKFD
GSGQPIVAIKGAKLSDYGGRSLSASFSSTMMINPDIPEAYKLRGWFDKEGHALEGQSLTE
VRGGSGNYMENWKTLADVKSEHLGHGDKADYYSCIATIVFLRKENCLYQACPSQDCNKKV
IDQQNGMFRCEKCDKEFPNFKYRLILSANIADYGDNQWVTCFQESAEAILGQNAAYLGQL
KDSNESAFDEIFQHANFNTFVFRNRVKLETYNDESRIKATVMDVKPVDHREYSKRLIMNI
RKLGAK
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctttcagcgggggcaatagaggctttagcaaatggtagcggttggaacgag
gcagtgcttcagttggtgaatatacgcagacttgatggtggaaatgggcccgctcgcttt
agggtgatgatgagcgatggacgacacacactttcatcctttatgctctcaactcagcta
aactacatggccgaggaaaacattctggttccaaactgtgtgtgcctcctcaagaggcag
gtgacaaatatgctcaaagatggacgacgagtggtcatcattttagaaattcaggtcctg
aagcctgctgaagaggttggtggtaaaatcggagaccctacaccttactctgatggtcag
agtaaagggcagcagccagctccagccccagctccagctccagtgcctgaaaccagacag
ccactgcagcagcaaaatagaaatgaagtgaacaggaatttaaatcgagacttcatgaag
aaggttccctctgctttgcctgatactccagggggtggctccaaagttgtccccatcgct
agtctcaacccttaccagtccaagtggacaatccgtgctcgtgtaaccaacaagagctcc
attcgtacgtggagcaacgctcgcggcgaaggaaagctcttctcgatggagatggtagat
gagagcggagaaatccgtgtgactggttttaaccaagaagttgacaagtttttctctctg
atcgaggttggcaaggtctactatgtctccaggggctccctaaagatcgcaaacaagcag
tacacatcagtgaagaacgactatgaaatgactctcaatggagagtctaccgtcattccc
tgtgaggacagctgcgatgttcccatggtgcagtgtgactttgtctccattggggacttg
gaaaacagagaaaaggatgccattgttgacgtgattggagtatgtagaagtgtggacgag
gtgaccaaactcacaaccaagtccaaccgggaagtatctaagagaacattgagtctgatg
gacatgtctgggaagctggtgaatgtcacactgtggggagaggaagcagaaaagtttgac
ggctctggacagccgattgtagccataaaaggggcaaagctttcggactatggaggccgc
tcactttctgcatccttcagcagcaccatgatgataaacccagatatcccagaggcatac
aagctcagaggctggttcgacaaagaaggccatgccttggaggggcagtcgctgacggag
gtgagaggcggcagcggaaattacatggaaaactggaagacactggctgatgttaagtcg
gagcatcttggacacggcgacaaggctgactactattcctgcatagccaccatagttttt
ctgcgcaaggagaactgcctttatcaggcctgcccaagccaggactgcaacaaaaaagtg
attgaccaacagaatggcatgttccgctgtgagaagtgtgataaagagtttcctaacttc
aagtaccgcctcattctatctgccaacattgcggattatggcgacaaccagtgggtaact
tgcttccaggagagtgcagaggccattctgggccagaatgcagcttacttgggccagctc
aaggactctaatgaatcagcatttgatgagatctttcagcatgcaaacttcaacacgttt
gtcttccgcaacagagtgaagctggaaacgtataatgacgaatccaggatcaaggccaca
gtgatggacgtgaagcctgttgaccacagagagtacagcaagaggctgatcatgaacata
cggaaacttggcgccaagtag

KEGG   Cyprinodon variegatus (sheepshead minnow): 107102742Help
Entry
107102742         CDS       T06110                                 

Gene name
rpa3
Definition
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03030  DNA replication
cvg03420  Nucleotide excision repair
cvg03430  Mismatch repair
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107102742 (rpa3)
   03420 Nucleotide excision repair
    107102742 (rpa3)
   03430 Mismatch repair
    107102742 (rpa3)
   03440 Homologous recombination
    107102742 (rpa3)
   03460 Fanconi anemia pathway
    107102742 (rpa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cvg03032]
    107102742 (rpa3)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107102742 (rpa3)
DNA replication proteins [BR:cvg03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    107102742 (rpa3)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     107102742 (rpa3)
   MMR (mismatch excision repair)
     107102742 (rpa3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     107102742 (rpa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_3
Motif
Other DBs
NCBI-GeneID: 107102742
NCBI-ProteinID: XP_015257644
Ensembl: ENSCVAG00000001236
UniProt: A0A3Q2C6V8
LinkDB All DBs
Position
Unknown
AA seq 122 aa AA seqDB search
MAGILDVPKPRINCSMLSRFINRAVCFVGRVEKVHPSGKMFTVVDGESKTATVELNEPLE
EELSGVVEVIGMVSNKGDIMASTYNTLREDRGVPFDLELYNEALKVIHDFPQHYPFQVAA
SG
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccggcatcctggacgtcccaaagcccagaataaactgctccatgctgtcccggttc
atcaaccgagccgtctgcttcgtcgggcgggtagaaaaggttcatccgtctgggaaaatg
ttcaccgtggtggacggagagagtaagaccgccacagtggagctgaacgaaccgcttgaa
gaagagctgagtggagtggtggaggttattgggatggtgtccaacaaaggagacataatg
gccagcacatacaacaccctgagggaggacaggggcgtccccttcgatttagagctgtac
aacgaagcgctgaaggtcatccacgacttcccccagcactaccccttccaggtggctgcc
agcggatga

DBGET integrated database retrieval system