KEGG   Cyprinodon variegatus (sheepshead minnow): 107085125Help
Entry
107085125         CDS       T06110                                 

Gene name
atr
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
cvg04110  Cell cycle
cvg04115  p53 signaling pathway
cvg04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107085125 (atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107085125 (atr)
   04115 p53 signaling pathway
    107085125 (atr)
   04218 Cellular senescence
    107085125 (atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107085125 (atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107085125 (atr)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107085125 (atr)
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   107085125 (atr)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107085125 (atr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT HEAT_2 DUF2913 DUF4838
Motif
Other DBs
NCBI-GeneID: 107085125
NCBI-ProteinID: XP_015230779
Ensembl: ENSCVAG00000019865
LinkDB All DBs
Position
Unknown
AA seq 2594 aa AA seqDB search
MEGLEMSAMIPALQELASASAAEYDLAVQKPRQILCQFIDRILTDVDVVAIGLNKKSSSE
PACVMLLDFVQHIIKSSSLMFANPACQPAEYPDTIQSCTDFSKWVAVRLLRVAAAPGCGV
IHGRVSAVLCSLLHSFRVRVPFIFSCLIQEFILMAQDLSNILFAHIATLSGPGHDLGIYT
QNQWPVKLGRFLFSASSASYLTQTPLVLSSPAALESLTTVTVGIITDSLRGVVSCRDLSV
TLETACSILANGNTKLRKISMVMIRKLVELRKFDHIQNYNFFPAYFHLLETHNSSDEKEP
YEGELLKLTRCLFQSSYISPSDFESVYLSQMFECVCALGGAGIRFGSELTESLCVLFCFS
LSFGPSYEGAAVLRRQQVVDVCRTLASTIGTENQAECAEGFLRVALKADKATVMQKTGDG
ESPAKRSCKSGISELDMRVQSEVWASLNRRLEELLALLNSDSAEPESQQTASALRGVALV
LHLAAFCSSPVSSSCPLVWVSTETMSRVLRSCKSLLEGASRPVSDQDYFRSAFQSTIRVL
DSILYPTLSRQIEDGVQRLVCALLSLPWVCENKSVSAFKSSGFPSWLPPLAQRLSFCYSH
EVQADCVSLLAFLPRGVFENWRVCVFTNALQSQDEAVRATAVRVSPILLHHLGSRYRDII
STILLSLLEDKSEQVKVELARIVGQLSCIQSELSKLSDSDIEPMPLPKVLCLRWSLVTDH
AGNKTPSLKASVVKPFLTLLRPQAPNSFKLAFLEALPHLCQHVSLLGADSDSRAVLCSLL
GLIEDSDAGVRTSFSQSVRFLLTESTKHSEQGILNEVLVARLKEAFSNAKVRRDDDLRNT
LILTTGEIGRASQGSLVSFSLLRLLHCLLSKSSSVSVAAYTQIRALADAKGLKLQTLFSQ
YKNPICQFLVESLHSRHASALRSTPDQTSESANQRELALDILAQIAHAFDFPDLHRFLTK
TLQVLLPYLAAKASATGSALIRTLAIELKANRREILINNFKYIFSHLVCSCTKEELERAF
HYLQSETEIELGSLLRQDFQGLHNELLLRLGEHYQQVFNGLAILASFASNDDPYKGPRDI
TTPEHMADYLQPKLLGILAFFNMQLLSSSAGEKDRKKMALTSVIALMRLMGSKHISSVRV
KMMTTLRTGLRYREDFPLLCCQTWDCFVRSVELSHLGPLLSHVIVALLPLIPLQPKETAA
IIRFLILDNREEVNDYLHEIYFLPELPELKDIHTVLQDYKKLTASSSDLASALQLSMRAV
QHENVDVRIHALTSLRDMMHNKQEWLLRQVCASEAVEPVISSLVSVLLKGCQDSSPEARL
LCGECLGELGAIDPGRLDLSHARNHGDRNTFVSGVDDPNFAHDLLTELIRTFLAYADNVR
AQDSAAYAIQELLSIFECREGKTDSPGRRLWRRFPEQIQEILEPHLNSRYKSSQKEVNWS
KLKKPVYLSNRGSRFSDWSATWAGYLISKVRHELASKVFKCCSFIIKHDYKVTIYLLPHI
LLYMLQSSTPAEQLEVTEEMLAVLTEGDGRGEGSVQETASSLSQLSTQTVFSMLSHLTQW
SRHILYAKPKVNAESGDYQRVVTFLKGIPQDVLAKASLRSRAYTRALMHFEAYIMENKEN
IQDHLSFLQTLYAAMHEPDGVRGVNALRREEPSLREQILEHESIGLLRDATACYDRAIQL
ESDQIGHYHGVMTSMLGLGQLSTVITQVNGVLANKQQWKSELNTYRVEAAWKLGKWDLLE
DYLTTDQQSCTWGVRLGQLLLSANKQDAESFYEKLKLVRKEQVVPLSAASYECGTYQRGY
EYIVRLHMLSELEHAFTELQKTGDGSAPSLTKLPPHWSNRLEMTQNSFRAKEPILALRRA
LLSLRPQPVCQGLVGECWLQSARVARKAGHHQTAFNALLNADDTNLAELVTEKAKWLWSK
GDVHQALIVLQKGVAQCFPDDQLLTDPHNLQIKGKAMLLVGRFMEETANFESNAIMKAYK
DVTNLLPEWEDGNFYLAKYYDKVMPMVTDNKLEKQGNLIRYIVTFFGKALQFGNQYIYQA
MPRMLSLWLDFGAKVCDCEKAGRTDRAMRQELGKINTVVEEHCSNLAPYQFLTAFSQLIS
RVCHSSDDVFKVLMKIVAKVFLAYPQQAMWLMTAVSKSSYPMRMNRCNQILKKAISLKES
LEKFIGDANRLTDKLLELCNKPVDGNSTTLSMSIHFKLLKRLVEEPSFSQILIPLQSVLI
PTLPSTGGANTQHDAFPGHWAYLDGFEDAVEILASLQKPKKISLKGSDGQSYTMMCKPKD
DLRKDCRLMEFNCLINKCLRKDAESRRRELHIRTYAVIPLNEECGIIEWVNNTAGLRHIL
TKLYKERGVHLSGKELRKLILPKTAPFDEKLRIHKEVLCARHPPVFYEWFLRTFPDPESW
YSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFDVPEV
VPFRLTQNMVHAMGPMGTEGLFRQACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPSK
GLVKTQANETGEIVNEKAKTHVCEIEQRLQGVIKSRNKVLGLPLSIEGHVHYLIQEATDD
KLLCQMYLGWGPYL
NT seq 7785 nt NT seq  +upstreamnt  +downstreamnt
atggagggacttgaaatgtctgcaatgattcccgctcttcaggagctagctagcgccagt
gctgctgagtatgacttagcggtgcagaaaccccgacagatcctctgccagttcattgac
aggatactgacagatgtagacgttgttgctataggtctgaacaaaaagtccagttcagag
ccagcttgtgtaatgcttctggattttgtgcaacatataatcaaatcctcgtctctgatg
tttgctaatcctgcctgtcagcctgctgagtatccggacaccatacagagctgcactgac
tttagtaagtgggtagcagtacgtttacttcgtgtggcagcagctccaggctgtggcgtg
atccatgggagggtctctgctgtgctttgctctttacttcactctttcagggtcagagtg
cccttcatcttcagctgcctcattcaggaattcattttaatggcccaagacctcagcaac
atactatttgctcatatagcaacactatcgggaccaggacatgacctgggcatttacacc
cagaaccagtggcctgtaaagctcgggcgtttcctcttctctgcctcctctgcctcctac
cttacccagactccacttgtactgtcatctccggctgccttagagtcactgaccactgtc
actgttggtatcataaccgactctctgcggggagttgtttcctgtcgggatctgagtgtg
accctggagacagcctgctccatcttggcaaacgggaacaccaaactgaggaagatttct
atggtgatgataagaaaactggtggagctaaggaaatttgaccacatccagaactacaat
ttcttcccagcctattttcaccttctcgaaacacacaacagctcagatgagaaggaaccc
tatgaaggagagctcctcaagctcacccgctgcttgtttcagtcatcctacatttctccc
tctgattttgagtccgtctacctctcgcagatgtttgagtgtgtctgcgctctcggagga
gcaggcattaggtttggatcagagcttactgaatcgctctgcgtgcttttctgcttttcc
ctgtcttttggcccgagttatgaaggtgctgcagtgctacggaggcagcaggtggtggac
gtctgcaggacgctggcgtcaaccattgggacagaaaatcaagctgaatgtgcagaaggc
ttcctaagagttgctctgaaggcggataaagctactgtgatgcagaagacgggagatgga
gagtctcctgccaagagatcatgcaaatctggcatcagcgagttggacatgcgggttcaa
agtgaggtttgggcctcattgaaccggcgccttgaagagctcctggctcttttgaactct
gactcagcagaaccagagagccagcagacggcgtcagccctacggggcgtggccctcgtc
ctccatctggcagccttttgctcctcgcctgtaagcagttcctgtcctctggtctgggtg
tccactgagactatgagccgagtgctgaggagctgtaagtccttgttggaaggagcgtct
cgacccgtctctgatcaggactactttagatctgcttttcaatccaccatcagggttctt
gactccattctctacccgacattgagccgccagattgaagatggggtacagcggcttgtc
tgtgctctgctgtctcttccttgggtttgtgaaaacaagtcagtctcagcctttaagagt
tcagggttcccctcctggctgccccccttggctcagagactcagcttctgttattcacat
gaagtccaggcagattgtgtgtcgttgctggcctttctgcctcggggtgtgtttgaaaac
tggcgcgtctgtgtcttcaccaacgcactgcagagtcaggatgaggcggtgagagccaca
gctgtcagagtctctcccatcctgcttcatcatctgggatcccgataccgtgacatcatc
agcaccattctgctgtctctgctggaggacaagtcagagcaggtgaaggtggagctcgcc
aggattgttgggcagctgagctgcatccagtcggagctctccaagcttagcgactctgac
atagaacccatgcctcttcctaaagtcctctgccttcgctggagtcttgtaacagatcat
gctgggaataaaacgccatccctcaaagcatctgtggttaaaccgtttctaactttacta
agaccacaagctccaaactcttttaaactagcatttctagaggctctacctcacctctgc
cagcatgtgagcctactgggcgcagacagcgactcccgggctgttctctgttccctgctt
ggcctcatcgaggactccgatgctggggttagaacaagttttagccaatcagtccgattt
ctgctgacagaatccacgaaacactcagagcagggaattctaaatgaggtccttgttgca
cgtctaaaggaggcattcagcaacgctaaagtcagaagagatgacgaccttcgaaacacc
ctcatcctcaccacgggagagatcgggagagccagccagggaagtttggtgtccttctcc
ttgctgcgtctgctccattgcctcctgtccaagtcatccagcgtttctgtggccgcttac
actcagatcagagcgctggcagatgccaaaggactgaagctgcagaccctgttcagccag
tacaagaaccccatttgccagtttctggtggagtcgctacattcccgccatgcgtctgcc
ctacggagcacaccagatcaaaccagcgaatctgccaaccagagagagctggctctggac
attctggctcagatcgcgcatgctttcgacttcccagacctccatcgcttcctcaccaag
acgctccaggtgctgctgccctacctggcagctaaggcgagcgccacgggctctgccctc
atccgtactctggccattgagctgaaggcaaacaggagagagatcctcattaacaatttc
aagtacatcttcagtcatctggtttgttcatgcaccaaggaggagctggagagagcgttt
cactacctacagagtgagactgagattgagctgggttctctactaagacaagacttccag
ggtcttcacaatgagctgctgcttcgcttgggagaacattaccaacaggtgttcaacggt
ttggcgatcttggcctcctttgcatccaacgatgatccatacaagggtcccagagacatc
accaccccagagcacatggcagattacctgcagcccaagctgctggggattctggctttt
ttcaacatgcagctgctcagctccagcgcaggagagaaggatcgcaaaaaaatggctttg
acgagtgtgatagctcttatgcgcctgatgggctctaaacacatcagctccgtcagagtg
aaaatgatgacgacgcttcgcactggtctccgttacagagaggacttccccctgctctgc
tgccagacgtgggattgttttgtgaggagcgtggagctttctcacctcggcccgctcctc
agtcatgttattgttgcactgcttcccttgatccctctgcagcctaaagaaactgctgcc
atcattcgtttcctcatccttgacaacagggaagaagtaaatgattaccttcatgagatc
tactttctgcccgagctcccagaactaaaagacattcacacagttctgcaggattacaaa
aagctgactgccagcagcagcgacctcgcctcggctctacagctgtcgatgagagctgtt
cagcatgagaacgtggacgtgaggatccatgctctgaccagcctcagggacatgatgcac
aacaagcaggagtggcttctgcggcaggtttgtgccagcgaggcggtggagcctgtcatc
tctagcctggtgtcagtgctgctcaaaggctgccaggactcatcccctgaggccaggctt
ctctgtggggagtgtctgggcgagctgggggccatagaccccggacgtctggatctgtct
cacgcacgcaaccacggcgaccgtaatacctttgtgagcggggttgatgatcccaacttc
gcccacgatttgctgactgagctcatcagaacatttctggcctacgctgataacgtgcga
gctcaggactcggctgcttatgccatccaggagctactgtctattttcgagtgtcgtgag
gggaaaacagactctccgggacgacgtttgtggaggaggttcccagaacagatccaagaa
atcctggagcctcatctcaacagcagatacaagagcagtcagaaggaggtcaactggtct
aaactgaagaagcctgtgtatcttagcaacagaggcagcaggttctctgactggtctgcc
acctgggctggatacctcatcagcaaggtgagacatgagctggccagcaaagtgttcaaa
tgctgcagcttcatcatcaaacacgactacaaagtcaccatctacctgctgcctcatatt
ctgctctacatgctgcagagcagcacccctgcagagcagctggaggtgacggaggagatg
ctggctgtgctgactgaaggagacggccggggagagggcagcgtacaggagacggcctct
agcttatcgcagctcagcactcagaccgtgtttagcatgctgtcacacctcacacagtgg
agccgccacatcctttatgccaaacccaaagtcaatgcagaaagtggtgattatcagcgt
gtggtgaccttcctgaagggtattccccaggacgtactggccaaagcctccctgcgatct
agagcgtacacccgggcgctcatgcactttgaagcttacataatggaaaacaaagagaac
atccaagaccacctcagcttcctgcagacgctgtatgcggcgatgcatgagcctgacgga
gtgaggggggtcaacgctctaaggagggaggagccatcactgagagaacagatccttgaa
catgagagcatcggtttactgcgagatgccacggcttgctacgaccgggccatacagctg
gagtcagaccagattggtcactatcatggagtgatgacctccatgcttggactgggacag
ctgtccacagtcatcacccaggtcaacggcgtactggccaataagcagcagtggaaatca
gagctgaacacctacagagtggaggctgcctggaagcttgggaaatgggacttgttagaa
gattatttaactacagaccagcagtcgtgtacctggggcgtgcggctcggacagttgctg
ctgtcagcaaataagcaggatgcagagagtttctatgaaaagctgaagctggtgaggaaa
gagcaggtcgtccctctgtcagcagccagttacgagtgtggaacctaccagaggggatac
gagtacatcgtcaggctccacatgctcagtgagctggagcacgctttcactgagctgcag
aaaacaggagacggctccgcccctagcctcaccaagctgcctcctcattggtcaaatcga
ctggagatgactcagaactccttcagggccaaggagccgattctggccctgcggcgtgcc
ctgctcagcctcagacctcaacctgtatgtcaggggctggttggagagtgctggctgcag
agcgcccgggtcgccaggaaggcgggacaccaccagacggccttcaatgctctgctcaac
gcagacgacacaaacctggctgaactggtgacggagaaagccaagtggctgtggtccaag
ggcgacgtgcaccaggccctgattgtcctccaaaagggcgtggctcagtgtttcccagac
gatcagctgctgactgaccctcacaacctgcagattaaagggaaggccatgctgctagtt
ggccgcttcatggaggagacagcgaactttgagtccaatgcaatcatgaaggcttacaag
gatgtgaccaaccttctcccagagtgggaggatgggaacttctacctcgctaagtattat
gacaaagtgatgccaatggtgacggataacaagctggagaagcaggggaacctgatccga
tacatcgtcacattctttggaaaagccctgcagtttgggaaccagtacatctatcaggcc
atgcctcgcatgctctccctctggttggattttggagcgaaagtgtgcgattgtgagaaa
gctggacgaacagaccgcgcaatgcgacaggagctcgggaagatcaacactgtggtggaa
gagcattgctctaacttggctccctaccagttcctcactgccttctcccagctcatctcc
agggtgtgtcactccagcgatgatgtcttcaaggtgctcatgaagatcgtggccaaagtg
ttcctggcgtacccccaacaggccatgtggctgatgacggctgtctccaagtcttcttac
ccaatgcgcatgaaccgctgcaatcagatccttaagaaagccatcagtctgaaagagtcc
ctggagaaatttatcggagatgctaacagactcaccgacaagctgcttgagctctgcaac
aagccggtggacggtaacagcaccacccttagcatgagcattcacttcaagctgctgaaa
cgtctggtagaggagccaagcttcagtcagatcctcatcccgctgcagtccgtcctcatc
ccgacactgccctctactggcggggcgaacacacagcatgacgccttccccggacactgg
gcctacctggacggctttgaagacgctgtggagattttggcctccctgcagaagcctaag
aagatcagtctgaagggctccgatggccagagttacaccatgatgtgtaaacctaaagac
gatctaagaaaagactgcaggctgatggagtttaactgtctcatcaacaagtgccttcgt
aaagatgcagagtcgaggcgaagggagctccacatccgcacctacgctgtgattccactc
aacgaggagtgcggcatcatcgagtgggtcaacaacactgctgggctgcgacacatcctc
accaaactgtacaaagagcgaggtgtccacctgtctggtaaagagctgaggaagctgatt
ttacccaaaacagctccctttgatgaaaagctcagaatccacaaggaggtgctgtgtgcc
cggcatccgcccgtcttttatgagtggttcctccgaacgtttcccgaccctgaatcctgg
tacagcagtcgctctgcgtactgccgctccactgctgtgatgtccatggtcggctacatc
ttgggacttggtgatcgtcatggagaaaatatcctctttgactcttttactggcgaatgt
gtccacgtggactttaactgcctctttaacaagggggagacatttgacgttccagaggta
gtaccattccgactaacccaaaacatggtccatgctatggggcctatgggtactgagggc
ttgtttaggcaagcctgtgaagtcacactgagactgatgagagaccagagagagccactc
atgagcgtgctgaagacttttcttcatgacccgctggttgagtggagcaaaccatccaaa
gggcttgtgaaaacccaggccaatgagacaggggagatagttaatgaaaaggccaaaaca
cacgtgtgtgaaattgagcaacgtctccaaggggtgataaagagccggaataaagtactt
ggtctccctctgtcaatagagggacatgtgcactacctcatccaggaagccactgatgac
aaattgctctgccagatgtatttgggttggggtccatacctgtaa

DBGET integrated database retrieval system