KEGG   Cyprinodon variegatus (sheepshead minnow): 107085174Help
Entry
107085174         CDS       T06110                                 

Gene name
poli
Definition
(RefSeq) DNA polymerase iota
  KO
K03510  DNA polymerase iota [EC:2.7.7.7]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107085174 (poli)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107085174 (poli)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107085174 (poli)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    107085174 (poli)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C DNA_pol_lambd_f IMS_HHH Cdd1 UBM HHH_5
Motif
Other DBs
NCBI-GeneID: 107085174
NCBI-ProteinID: XP_015230859
LinkDB All DBs
Position
Unknown
AA seq 625 aa AA seqDB search
MDFNESEMEEDESEWKTCFMDPAALCPATSATAASESTIKTPEPAQKVILHFDLDCFYAQ
VEMIRNPALRDVPLGIQQKYIIVTCNYVAREQGVTKLMSVTDAKEKCPKLVLVKGEDLTH
YREMSYKVTEVLLSYCPLVERLGFDENFVDVTELVEQRLAQTSQPDSLSFKGHVFNHSSA
DVKGSDHPRLAIGSHIAAELREAIHSKLGLTGCAGVATNKLLAKLVSGTFKPNQQTVLLQ
ENIGDIMGCLSGLRKVPGVGHQTAKRLQALGLMSVKDLQLYPLNDLAREFGGGTAQRLKN
LALGIDDSAVTPTGAPQSLSDEDSFKKMCSVKEVMEKIHELLSSLVERMHKDGRQPQTFR
LTIRKYSATNKWFSRESRQCPIPGSTGQKILSGTLKNSSQNSESFLLGHQVNSCSRIAPA
NNKVTTKDTCGQSLHVLGLEQSSVYAAEENHQASCSTERISSNETKPPPNVDPEVFKLLP
EEIQKEILSPSYFKSQPSPSASETHHMSTNKPQEKDLPMKVKSSSMNPPWPAGVHVNHGE
NVTENLSLPQSSDCNFPGNVDPKVFSELPSEVQKELLAEWKQQKPILKTPSSRKPGKAST
SKGKDRKAEGRASQSNNLFKYFKPG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaacgaaagtgagatggaggaagatgagagcgagtggaaaacttgcttcatg
gatccagctgcgctctgccccgctacctctgcaactgcagcttctgagtcaaccatcaaa
actccagaacctgcacaaaaagttattttgcattttgaccttgattgcttttatgctcaa
gtagaaatgatcagaaatccagctctaagagatgttcctttaggtatacagcagaaatac
atcatagtcacctgtaactatgtggccagggagcagggtgtcaccaagctgatgtctgtg
actgatgctaaggagaaatgtcctaaactggtgctggtgaaaggagaagaccttacacac
tacagagaaatgtcctacaaagtcacagaggtcctattgtcgtattgtcctctggtagaa
aggcttggatttgatgaaaactttgtggacgtaacagagttggttgaacagaggcttgcc
cagacatcacagccggacagcctttcatttaaaggacatgtcttcaatcattccagtgca
gatgttaaaggcagcgaccacccaaggctggccataggttcacacattgcagcagagcta
agagaggctatccatagcaagctcggcttgaccggttgtgctggcgtcgccacaaacaag
ctgcttgccaaactggtttcaggcaccttcaaaccaaaccagcagactgttttactgcag
gagaacatcggggatatcatgggctgtctgagtggcctcagaaaagtacctggcgttggc
caccaaactgcaaagagacttcaagctttaggattaatgagtgtaaaagacttgcagctc
tatccactgaatgacttagcgagggagttcgggggcggcacagcccagcgcttaaaaaac
ctggccctgggcattgatgactcagccgtcacgcccactggggcccctcagtctctcagt
gatgaagactcctttaagaaaatgtgttcagtgaaggaagttatggaaaagattcatgag
ctcctcagcagtctggtggagaggatgcacaaagatggccggcagcctcaaaccttcagg
ctgacaatacgaaaatactcggcgaccaacaagtggtttagtcgggagagccgccagtgt
ccgatcccaggcagcactggacagaagatcctctctggtacgctgaaaaattcatcccaa
aactctgagagtttcctcttgggccatcaggtcaactcatgcagcaggattgctccagca
aataataaagtcaccacaaaagacacttgtgggcaatcattacatgtgttaggactggaa
caaagctctgtttatgctgctgaggaaaaccatcaagcatcctgcagcacagagagaatc
agttctaatgaaaccaaaccaccaccaaatgttgacccggaggtttttaagctccttcca
gaagaaatccagaaggaaattttgtctccttcttattttaaatcccagccaagcccctca
gcgtctgagacccaccacatgtcaacaaacaagcctcaagaaaaagatttaccaatgaaa
gtgaagtcatctagtatgaatccgccttggccggcgggagtacatgtaaatcacggagaa
aacgtcacggagaacttatcgctcccccagtcatctgactgtaacttcccgggaaatgta
gaccccaaagtgttttctgaacttccttcagaagttcagaaggagctcctggctgagtgg
aagcagcagaagccaattttgaaaactccttcttcaagaaaaccaggaaaagcctcgacc
tccaaaggcaaagatagaaaggctgaagggagagccagtcagtccaataatctgttcaag
tatttcaaacctggttag

DBGET integrated database retrieval system