KEGG   Cyprinodon variegatus (sheepshead minnow): 107085617
Entry
107085617         CDS       T06110                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04012  ErbB signaling pathway
cvg04068  FoxO signaling pathway
cvg04110  Cell cycle
cvg04115  p53 signaling pathway
cvg04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107085617
   04068 FoxO signaling pathway
    107085617
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107085617
   04115 p53 signaling pathway
    107085617
   04218 Cellular senescence
    107085617
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107085617
NCBI-ProteinID: XP_015231547
Ensembl: ENSCVAG00000023333
UniProt: A0A3Q2EJZ7
LinkDB
Position
Unknown
AA seq 168 aa
MCRTMATHMSMLSPLRGNRRTRRNLFGPVDRDQLQMEYKAALGKDLDEVSRRWGFDFRSD
KPLERSDFEWEGIAEARVPLLYRSCVLAGGQAEGLRMGGAPLVRGTKEARMQKENIPQTP
EKCATELEGLERTPEKTDKAGLKRKQTNITDFYQAKRRVVWMPRKSGQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtgcagaaccatggccactcacatgtcaatgctgagccctctgagggggaatagacgc
acccgccggaacctgtttggccctgtggaccgagaccagctgcagatggagtacaaggcg
gcactgggtaaagacctggatgaggtatcaagacgatggggctttgacttcaggtctgac
aagcctctagagagaagcgactttgagtgggagggcatcgcagaagccagggtcccactg
ctctacaggtcctgtgttctggctggtggacaggcagagggcctgaggatgggaggggct
cctttggtcagagggaccaaagaagcgaggatgcagaaggagaacatccctcagacgcca
gagaaatgtgcaacagagctggagggcctggaaagaaccccggaaaagacagacaaagct
gggctgaagaggaaacagacaaatatcacagacttctatcaagccaagagaagagttgtg
tggatgccgaggaaatctgggcagtga

DBGET integrated database retrieval system