KEGG   Cyprinodon variegatus (sheepshead minnow): 107087406Help
Entry
107087406         CDS       T06110                                 

Definition
(RefSeq) fanconi-associated nuclease 1-like
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107087406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107087406
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     107087406
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     107087406
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107087406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC TPR_12 SAP zf-WRNIP1_ubi
Motif
Other DBs
NCBI-GeneID: 107087406
NCBI-ProteinID: XP_015234461
LinkDB All DBs
Position
Unknown
AA seq 1132 aa AA seqDB search
MAERTSRGKLRRSLSLKNKKRQEAKAGSASISSFFSSQPPPSLACPLCGQLVPRFKINDH
IDLQCQNFDRGGGGGGGGNDASPQSELEQREEDTQTKTSPYFKKKICDQTPRDINSKTVV
RAIGLGSLSSKLSRHDRSKHAEVRDKPDQMSDAESTSSSQKENVQVEDSSGSVVCSSMEP
PAASAPLPAEKPAQVELPSEPPAKLTRRKKKAASSVRGKKAKYEGQRESEEASSGLGPEE
SSGGQQEADASPSPPDTLTSEEVKEQKQREDSAERPAAPSLPYYLRNFQTVLHAVLENED
DRTLFNQEDMSAVHGFQRLSVMAQKLYVRLFQRKLKWLQVNKLDYGEISSDLGPVAQELV
QLGFLQTENDLEDLGEALDLLPAPELKALAKTFHLGSSGTQKQQLVDGLLRLSRQRSFFS
LASSESRVGTVILKRAKQLAGSCVRLSRGPRAVFSRILLLFSLTDTMDEEEMAAGGQNQL
FTILLVNSGRLAFPDYTVQRVAKVFRDREDLIRYEASMRALLEVTLAMQAGQWEQALELY
NAAKGAWCQLRLNHDLSHQEELPVFLRSFTTGWAYTRILSRGVEILQRLRRYEEAVEELQ
ALLKQSVYCPDSRGRWWDRLALNLHQHLKKPDQAICAIREGLSDPLVRTGHKLSLHQRAL
RMKEAPSCKKYRLQLRELPTLQVQDVKHVTIRGQLFPHEGGTGKSRFLIPESEEGEGSII
CSVEEFCLDHYRQLGFDQGIHGEGSTFSTLFGLLMWDIIFMEGIPDVFRNPYQTCPLDFY
TDCFYENRKEAIASRVGLLQEATVETLRDMLQDVWESQEGKVCSLVSWERFSSLQQAQVL
CIDSIHILLIFLSIALEEFDRNRRIWINVLNVAQVFTLWREGLSDPLVRTGHKLSLHQRA
LRMKEAPSCKKYRLQLRELPTLQVQDVKHVTIRGQLFPHEGGTGKSRFLIPESEEGEGSI
ICSVEEFCLDHYRQLGFDQGIHGEGSTFSTLFGLLMWDIIFMEGIPDVFRNPYQTCPLDF
YTDCFYENRKEAIASRVGLLQEATVETLRDMLQDVWESQEGKVCSLVSWERFSSLQQAQL
VEVKGPNDRLSQKQQIWLDELQKLGADVEVCHVTATGARGARQEETNIQASN
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagaacgagcagaggcaaactgaggcgaagcttgtctctgaagaacaagaag
agacaagaagctaaagctggaagtgcttcaatcagctctttcttcagcagccagcctcca
cccagcctggcctgccccctgtgtggacaactggtccccagattcaagatcaatgatcac
atcgacctgcagtgtcagaactttgatagaggaggaggaggcggcggaggtgggaatgat
gcttcacctcaatctgagctggagcagagagaggaggacacacaaaccaagaccagccct
tatttcaagaagaagatctgtgatcagaccccacgtgacataaacagtaagactgtggtc
agagccattggcttagggagtctctcctcaaagctttccagacatgatcgcagcaaacat
gcagaggttagagataaacctgaccagatgagtgatgctgagtcaaccagcagctcccag
aaggaaaatgttcaggtggaagacagcagtggttcagtggtctgcagcagcatggagcct
ccagcagcatcagctccactgcctgcagagaaaccagcacaggtagagcttccatctgaa
ccacctgcaaaactaacgaggaggaaaaagaaagccgcctcctctgtcagaggaaagaaa
gcaaaatacgaaggtcagagagagtctgaggaggcgtcttctggtttgggtccagaggaa
agcagtgggggacagcaggaagctgatgcgtctccatctccccctgacaccctgacatca
gaggaggtgaaggaacagaagcagagggaggattctgcagagagacctgctgctccatca
cttccctactacctgaggaacttccagaccgtgctgcacgccgtgttggagaacgaagac
gacaggacactcttcaaccaggaggacatgtccgccgtccatggattccagcggttatct
gttatggctcagaagctctatgtgaggctcttccagaggaaactaaagtggctccaggtc
aataaactggattatggagaaatcagcagtgatctgggacctgttgcacaggaactggtt
cagttaggatttctacagacagagaatgacctggaggacctcggagaggctctggatctc
ctgccggctcctgaacttaaagctctcgctaaaactttccatctgggctcttctggcacc
cagaaacagcagttagtcgatgggcttctccgtctgagcaggcagaggtcttttttctct
ctggcctccagtgaaagcagagttgggacagtgatcctgaaacgggcaaagcagctggcg
ggctcctgcgtgcgtctgtctcgtgggcctcgggccgtcttctcccgcatcctgctgctc
ttctctttgacggacaccatggacgaggaggaaatggccgccggcggtcagaatcagctt
tttaccatcctgctggtcaactcgggtcgtctggcgttcccagactacaccgtgcagcgg
gttgccaaggtgttccgagatcgagaggatctcatcagatatgaagcatccatgcgagcc
cttctggaggtgaccctggccatgcaggctggtcagtgggagcaggcgctggagctttac
aacgccgctaaaggagcctggtgccagctccgcctcaaccacgacctgagtcaccaggaa
gagctgccggtcttcctccgcagcttcaccacaggatgggcctacacccgcatcttatcc
agaggagtggagattttacagaggctgcgtcgctatgaggaagcagtagaagaactgcag
gccttactgaagcagtcggtttactgtcctgacagccggggccgatggtgggacaggctg
gctctgaaccttcaccagcacctcaaaaagcccgatcaagctatctgtgctataagagag
gggttgtcggatcctctggttcgcacaggacacaaactctccctgcatcagagagctctc
aggatgaaagaggctcccagctgcaaaaagtaccgactccaactccgagagctgcccacc
ctccaagtccaagatgttaaacatgtgaccattcggggccagctgtttccccatgagggt
ggcacgggaaaatctagatttcttattccagagagtgaagaaggggaagggagcataatt
tgctctgtggaggagttctgcttggaccattaccgacagctcggctttgaccaagggatc
catggagagggatcaacattctccaccttgtttggtcttctgatgtgggacattatcttt
atggaaggtattcctgatgtctttaggaacccataccagacttgtcctctggacttttac
accgactgtttctatgaaaacagaaaggaagcaatagcctctcgtgttgggctgcttcag
gaggccacagtggaaacgctgcgcgacatgctgcaagatgtctgggaatcccaggagggc
aaagtgtgttcgctggtcagctgggagcgattctcatccctccagcaggctcaggtactc
tgcatagattccattcacattttattaatttttttaagcattgcattagaagagttcgat
agaaacagaagaatttggatcaacgtactaaatgtagctcaagtttttacgctctggaga
gaggggttgtcggatcctctggttcgcacaggacacaaactctccctgcatcagagagct
ctcaggatgaaagaggctcccagctgcaaaaagtaccgactccaactccgagagctgccc
accctccaagtccaagatgttaaacatgtgaccattcggggccagctgtttcctcatgag
ggcgggacgggaaaatctagatttcttattccagagagtgaagaaggggaagggagcata
atttgctctgtggaggagttctgcttggaccattaccgacagctcggctttgaccaaggg
atccatggagagggatcaacattctccaccttgtttggtcttctgatgtgggacattatc
tttatggaaggtattcctgatgtctttaggaacccataccagacttgtcctctggacttt
tacaccgactgtttctatgaaaacagaaaggaagcaatagcctctcgtgttgggctgctt
caggaggccacagtggaaacgctgcgcgacatgctgcaagatgtctgggaatcccaggag
ggcaaagtgtgttcgctggtcagctgggagcgattctcatccctccagcaggctcagctg
gtggaggtgaagggccccaacgaccgtttgtctcagaagcagcagatctggttggatgaa
ttgcagaaactcggggctgacgtcgaggtgtgtcatgtgacggccaccggagccagagga
gcccgtcaggaggaaacaaacatacaggcgtctaattag

DBGET integrated database retrieval system