KEGG   Cyprinodon variegatus (sheepshead minnow): 107087511Help
Entry
107087511         CDS       T06110                                 

Gene name
ppcs
Definition
(RefSeq) phosphopantothenate--cysteine ligase
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00770  Pantothenate and CoA biosynthesis
cvg01100  Metabolic pathways
Module
cvg_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    107087511 (ppcs)
Enzymes [BR:cvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     107087511 (ppcs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 107087511
NCBI-ProteinID: XP_015234606
Ensembl: ENSCVAG00000011977
UniProt: A0A3Q2E4Z5
LinkDB All DBs
Position
Unknown
AA seq 317 aa AA seqDB search
MAEPKISSIDGKLAEEFAVPSHVEEVKEKMATFATHHAQAGRRVVLITSGGTKVPLESRT
VRFLDNFSSGRRGASSAEYFLDSGYAVIFLHRHRSLYPYTRMFLTINMLDALQFRGGEGG
GEVVVDQQVLPDIGRVLKRYNEVKDGGLLLPIEFNTLSEYLHLLKAAAQALSTIGSKAMF
YLAAAVSDFYIPASEMPEHKIQSSNGPLQLSMKMVPKILSPLVKDWAPQAFVTSFKLETD
PSILLDRARRALDTYRHQAVVANVLDSRRGYVVVVTPETQAELVLTEEEVKKDVEIEERI
VSNLTSAHSSFITGSQK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcccaaaatatcttccatcgacggaaagttggccgaagagtttgctgttccc
tcccatgtggaggaggtcaaggagaagatggccactttcgccactcatcatgcccaagca
ggtcgcagagttgtcctcatcacgtcaggaggcaccaaagtccccttggagtcacgcacc
gtccgtttcctagataacttcagcagcgggaggcgaggagcctcctcggccgaatacttc
ctagactcaggctacgccgtcattttcctgcacaggcaccgttctctctatccctacact
cgcatgtttctaaccatcaacatgctggacgccctgcagttcaggggaggagaaggaggc
ggtgaggtagtggtggaccagcaggtactcccggacattggcagagtactaaagcggtac
aacgaagttaaggacggaggacttctccttcccatcgaattcaacactctttcagagtat
ctgcatttactaaaagcagcggcacaggcgctcagcactataggatcaaaggccatgttt
tacctggctgcagccgtgtctgatttctacatacccgcctcagagatgcctgaacacaaa
atccagtcttccaacgggcctcttcagctcagcatgaagatggttcctaagatcttgtca
cccctcgttaaggactgggcgcctcaagcgtttgtcacatccttcaagctggagacggat
cccagcatcctgctcgacagggcccggcgagccctggacacgtacagacaccaggcggtg
gtcgccaacgtgctggactcccggcggggttacgtggtggtcgtgaccccggagacccag
gctgagctggtcctcactgaggaggaggtgaagaaggacgtggagatagaggagaggatt
gtgagcaacctcacatcagcgcacagcagctttataactggctcacagaaataa

DBGET integrated database retrieval system