KEGG   Cyprinodon variegatus (sheepshead minnow): 107088066Help
Entry
107088066         CDS       T06110                                 

Gene name
fancm
Definition
(RefSeq) Fanconi anemia group M protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107088066 (fancm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FANCM-MHF_bd DEAD ResIII Helicase_C ERCC4
Motif
Other DBs
NCBI-GeneID: 107088066
NCBI-ProteinID: XP_015235483
LinkDB All DBs
Position
Unknown
AA seq 2002 aa AA seqDB search
MSGGSNQRTLFQTWGASVSQNKTVHAGKNVGKTSGANRSTSSSSSRAQVAAVNPPLPPHQ
KAPWTEIGRNSTYEAERQAGVEYFISDDDEDDDLMVVAVYEAEKSLQLENANSFHNNHAT
GQNLAPLSTQSCGRIYPDFPGFDSSSAEVWIYPTNYPIRDYQLKISEASLFQNTLVCLPT
GLGKTFIASVVMYNFYRWYPAGKIVFMAPTKPLVAQQIEACYKVMGIPQEHMAELTGSTA
AKQRQEVWRSKRVFFLTPQVMVNDLSRDTCPAKQIKCVVIDEAHKALGNHAYCQVIKQLS
SQTLHFRILALSATPGGDAKSVQSVISNLLISHIELRSEESPDIQAHSHQRSVEKVVVPL
GDKLSAYQGRYLQVLEKFTSRLVQNRVMAHKDLRLLSKYQLILARDQFRKNPAPHIKGSH
QGILEGDFALCISLYHGYELLMQMGLRSLFFYIQGIMDGSREMSRARNELQRTPTFMDLY
HEMETMFLKPPGPDEPFIYSHPKLEKLEEVVVQHFNVWAESSADTNDGVSTRVMIFSSFR
ESVQEIATMLNQHAPLIKVMTFMGQASSGKGVKGFTQKEQLEVVHRFRQGGFNTLVSTCV
GEEGLDIGEVDLIVCFDAQKNPIRLVQRMGRTGRKRRGRIVIILTEGREERTYNQSQSNK
RSVYKSITSNKNGFRMYPNSPRMLPEGVNPKLHKMHITCGQFDHREGSRRSIRGRRSHSE
GRASLIHPHNLIQQISPKSDGFLSGTEYSLWASTMKLTEDEPHPTLKPSHFMSIPNDSTP
QEDNSRDKPPSRELSLWEWRHWQHRPLPFHAVDHSLRCHHFIKVMELIDGMRDEKEGECR
YEQQLSSYLHGDTDTSKKKPKAAKIGTKNNKNKVKACHSSRSELEYIDEEAEMDTATVAR
FSSTSIPEKRRLPDDGSTDGPPEEDLGAAPSHSFNNDSDVATITEAEQSFRDPAETDDVI
ALNARNDEDDDLEEMFYLPKNCSVSRPHSDKPRRDESLKAILSNVAELLSRSPPSLESIL
EAGEAWKCHPPSPQMPLQPFPVSFSLEVDDDENDDSCDDVSAPDQNFDEPVTVQGGGEDG
EPDSPTWDEVFEDEEIVDENSRDDEKETDSKKGDDVTRLEDAAVVEDEDFSSNLQMDESM
DLFEDDEAFMQMTIPDIPTPEDSFPARETNVSHAEDCIEKMAEGEHDEALGVKLTIQSSH
NMSHRQAEFHKPADHSQKAASCFQSSTVRENPEQLDSSHDLFSVNFDLGYSLDDSEDETE
MEAAPASPSPKKPADSAAPLPSTSTSSTPRNIFTGRLRESKLSSSQTKVSCWKSKAEELP
SPVPSLGTRRTLLSGFTKPASSSPKWSRAEGGVAAMSTNSSSWQEPVHVRESSPNPAPYS
DSEEEVVQHKRRQHKVNPLSSPDVSKVLSDVDSPVVVKKKRASVLNVTDETQAEAFSDDD
FQDDSMLTRRKTPPGAKRQLVQRPQKKNTMGQKARQFLDEEAELSEDEEEADVSSDEEDG
AELNRSLEGFVVDNTHLSQGLDDSEMQGVYLKSVRSPAVRGKFKMSYKKHHNMDIFSQVP
EMDETYAEDSFVVGSDEEELVCNEEEPEDIELLPEVSYMDGRRQYATRRRVFLHKARAKA
GAENRTESAAEQRTKTKRSRVICLDDSSEEETGDECKNRGSSTAGSAVPLQANRPHPEPS
GQKSTSSASVTIATKISSLSKGQRSSLSEEQQNERCRRTLENQHLLSDELDFAAPKPTIN
AAKEYQGLPTTKAPQSSTAQAPSMNGPPSPSGSVSILVDSRCISSGVELMTSLRQRHGAN
VHVCSLDSSYFIVSNRMAVERLSQSDLAAMQNRKRLVERLSSLQGMFERVCVIVEKDRSK
QGEVSRPFQRTRYYDSTIAALVRAGIRLLWSDGAEESAGLLADLAKLEHRKGQGIAVPLE
VKGQRRQQTLQLYQSLPWISHVHALNLLHNFSTIAQLINSSVEAIQKGGCMSRSRAEEIY
RCLRYSCDSSFLLNTSKAGKNS
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggttcaaatcagagaactttgttccagacgtggggagcttctgtatcccag
aacaaaacggtccatgcggggaaaaatgttggaaagacctccggagcgaacaggtcaacc
tcaagcagcagcagcagagctcaggtagctgcagtaaaccctcctcttcctcctcatcag
aaggctccatggacagaaattggcaggaatagcacatatgaagcagagagacaagctgga
gtggaatacttcatctctgatgatgatgaggatgatgacttgatggtggtagctgtctat
gaagctgagaagagtctccagcttgagaacgccaacagttttcataataatcatgcaaca
ggacaaaacctagctcctctttctacccaatcctgtgggagaatatatccagatttccca
ggctttgacagctcctcagctgaagtatggatctatcctaccaactatcccatcagggat
tatcagctgaagatatcagaggcttccctgtttcagaacaccctggtgtgtctaccaact
ggtttggggaagacattcatagcctctgtggttatgtacaacttctatcgctggtatcca
gcaggaaagattgtgtttatggctcctaccaaacctctggtggcgcagcagatagaggcc
tgttataaagtaatgggcatccctcaggaacacatggcggagctgacaggcagcactgca
gcgaagcagaggcaggaggtgtggaggtccaaacgcgtcttcttcctcacccctcaggtc
atggtgaatgatctttcaagagacacctgtccagcaaagcagatcaagtgtgtagtgatt
gacgaagctcacaaagcgttgggcaaccatgcttactgtcaggtaatcaaacagctgagc
agccagaccctgcatttccgcatcctggctctcagtgccactcctggaggagacgcaaag
tcggttcagtctgtcatctccaatctactaatatcacacattgagctgcgttcagaggag
agcccggacatccaggctcattcccatcagcggagtgtggagaaagtggttgttcctctt
ggtgataaactgtcggcttaccagggacgctaccttcaggttctagaaaagttcacatcc
cgtctggttcagaatcgagtgatggcccacaaagacctgcggcttctcagcaaataccag
ctcattcttgccagggatcagttccggaagaacccagcgccgcacatcaagggatctcat
cagggaatactggagggcgactttgccctttgcatcagtctgtaccacggttatgagctg
ctgatgcagatgggtctccgatcacttttcttttacatccagggaatcatggatggatcc
agagagatgtccagagcaaggaatgaattacagaggacacccacattcatggacctgtac
catgagatggagaccatgttcctgaagccaccaggtccagatgaaccattcatttacagt
catcccaaactggagaagctggaggaggtggtggtgcagcacttcaacgtgtgggctgag
agctccgcagacacaaatgacggagtgagcacacgtgtgatgatcttttcttcattccgg
gagagcgtccaggagatcgccaccatgctaaaccagcatgctccgctgataaaggtcatg
acgtttatgggacaagcctcttctgggaagggggtcaaaggcttcactcaaaaggaacaa
ctggaggtggtccacaggttccgacagggtgggtttaacaccctggtctcaacctgtgtg
ggagaagaagggctggatataggggaggtggacctcatcgtctgcttcgatgcacagaag
aaccccatccgcctcgttcagcgaatgggacgtactggacgcaagcgacgggggcgcatt
gtcatcatcctcacagagggaagggaggagaggacctacaatcaaagtcagagcaacaaa
cgcagtgtgtacaagtccatcaccagcaacaaaaatggcttccgcatgtatcccaacagt
ccccgcatgttgcctgagggggtgaaccctaaactgcataagatgcacatcacctgtggt
cagtttgaccaccgagagggcagcaggaggtccataagaggccggcggtcccactctgag
ggccgggcttcactcattcaccctcataacctgattcaacagattagcccaaaatcagat
ggctttctgagcggaacagaatattctctgtgggcgtccaccatgaagctgacagaagat
gagcctcatccaactctaaagccgtcccactttatgtccattcccaacgactcaacgcct
caggaggataattcaagggacaaaccaccttccagggagctgtctctgtgggaatggaga
cactggcagcacagaccccttcctttccatgcggttgatcattccctccgctgccatcac
ttcatcaaggtgatggagctcatagatggcatgagagatgagaaagagggggaatgccgg
tacgaacagcagctgtcttcctacctccatggagacaccgacaccagcaagaagaaacca
aaagctgcaaagatcggcacaaagaataataagaacaaagttaaagcttgtcactcgtcc
cggtctgagctggagtatatcgatgaggaggcagagatggatactgcaaccgtggcgagg
ttcagttctacatcaatcccagagaaacgaaggctcccagatgatggttccactgatgga
cctcctgaggaggatttaggagctgctccttcacacagctttaacaatgactctgacgtg
gctactattacagaagcagaacaatcctttagagatcctgcagaaacggacgatgttata
gcgttgaatgcaagaaatgatgaagatgatgatcttgaggagatgttctaccttcctaaa
aactgttctgtgtctcggccgcactccgacaaacccagaagagacgagagtctgaaggcc
atcctttccaatgtagccgaactcctctctcgatctccgccttcactggagagcatttta
gaggcaggagaggcttggaaatgtcatcctccatcacctcagatgcctcttcaacctttc
cccgtcagtttcagtttggaagtggatgatgacgagaatgatgatagctgtgatgatgtg
tcagctcctgaccagaactttgatgaaccggtgacggtgcaaggtggcggtgaggacggg
gagcctgatagtcctacctgggatgaggtgttcgaggatgaagaaatcgttgatgaaaat
agcagagatgatgagaaagaaacggattctaaaaagggagatgatgtaacgaggttggag
gatgctgctgtggtggaagatgaagacttttccagcaacctccagatggatgagagtatg
gacttgtttgaagacgacgaggctttcatgcagatgacaattccagatattcctactcct
gaggacagcttcccagcgagggaaaccaacgtctcacacgctgaggattgcattgaaaag
atggctgaaggtgaacacgatgaggctttaggtgtaaagctaacgattcaaagcagccac
aacatgtcgcacagacaagccgaatttcacaaaccagcagatcattcacagaaagctgct
tcctgtttccagtcttcgactgtgagagaaaatcctgagcaactagattcctctcatgat
ttattctcagttaattttgatcttggttattcgctggacgactctgaggatgaaacagaa
atggaagctgctcctgcttctccatctcctaaaaaaccagctgattctgctgcgcctttg
ccctcaacttctacttcctctactcctcgtaacatcttcacaggacgcctcagggagtcc
aagttatcttcttcacaaactaaagtgagctgttggaagtctaaggctgaagagcttcca
tctcctgtcccttcactgggtaccagacggacactcctgtccgggttcaccaaacctgcg
tcttccagtccaaagtggagccgagcagaaggtggcgtcgcagcgatgagcaccaacagc
agctcctggcaggaaccggttcatgtgagggaatcctctcctaatccagcgccttacagt
gacagtgaagaggaagtagttcaacacaaaagaagacaacacaaggtcaaccccttgtcc
tccccagacgtgtccaaagtcctgagtgatgtggactccccggtggtggtgaagaagaaa
cgtgcctctgttcttaatgtgactgacgaaacacaagccgaagctttttctgatgatgat
ttccaagacgactcgatgttgacacgcagaaaaacgccacctggagccaagaggcaacta
gtgcaacggcctcagaagaagaacacgatgggtcaaaaagcacgtcagtttctagacgaa
gaggcggagttatcagaggatgaggaggaagcggatgtttcgtctgatgaagaagacggc
gcagaactgaatcggtctcttgaaggcttcgttgtagacaacacgcacctgtcccaggga
ctggatgactcagagatgcagggagtttacctgaagtctgtgcgaagtcctgcagtccgg
ggcaaatttaaaatgtcctacaaaaaacaccataacatggacattttttcccaggtgcca
gagatggacgagacatatgcagaggacagctttgttgttggcagcgatgaagaagagctg
gtgtgtaatgaggaagagcctgaagacatcgaacttctccccgaggtgtcatacatggat
gggagaaggcagtatgcaaccagacggcgcgtttttctgcacaaagctagagcaaaggcc
ggagctgagaacagaactgagtctgctgcagagcagaggaccaaaaccaaacgctcccgg
gtcatctgcttagacgattccagcgaggaggagacgggggacgagtgcaaaaacaggggt
tcatcaacagctggcagcgctgtccctttacaggcaaacaggccacatcctgaacccagt
gggcagaaatccacgtcctctgcatctgtaaccatagcaactaaaatctcatcgttgagt
aaaggacagaggagttcactgagtgaagagcagcaaaatgagaggtgtcgtcgaacatta
gagaatcagcatcttctctctgatgagctcgacttcgcagcaccaaagccaactataaat
gcagcaaaagaatatcagggactccccacaaccaaagcacctcaaagctccactgctcag
gctccatcaatgaacgggccgccatcgccgtccgggtctgtctccatcttggtggacagc
cgctgcatcagtagcggcgtggagctgatgacgagtctccgtcagcgacacggtgccaac
gtccacgtttgctcgcttgacagcagctacttcatcgtaagcaaccgcatggccgtggaa
agactcagccaatcagatttagccgcaatgcagaaccggaagcgactggtggagaggctg
agcagcctgcagggaatgtttgaacgggtttgtgtaatagtggaaaaagatcggtccaag
cagggtgaagtttcccgtcccttccagcgcacacgttactatgacagcactatagcagct
ctggttcgtgcagggatccgcctgctttggagcgatggtgctgaggagagcgctggcttg
ttggcggacctggcgaagctggagcaccgtaaaggtcagggcatcgctgtgccgctggag
gtcaaagggcagcgaaggcagcagaccctgcagctgtaccagagtttaccttggatcagc
catgtgcacgcgctgaacctgctgcacaactttagcaccatcgcccagctgataaacagc
tctgtagaggcaatacagaaaggaggctgcatgagcagaagcagagctgaggagatctac
cgctgcctgcgttacagctgtgactcctccttcctcttgaacacttcaaaagcaggaaaa
aacagctag

DBGET integrated database retrieval system