KEGG   Cyprinodon variegatus (sheepshead minnow): 107088334
Entry
107088334         CDS       T06110                                 

Definition
(RefSeq) uncharacterized protein LOC107088334
  KO
K05461  KIT ligand
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107088334
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107088334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cvg04052]
    107088334
Cytokines and growth factors [BR:cvg04052]
 Growth factors
  Growth factors (RTK binding)
   107088334
SSDB
Motif
Pfam: SCF DUF2771
Other DBs
NCBI-GeneID: 107088334
NCBI-ProteinID: XP_015235932
Ensembl: ENSCVAG00000007029
UniProt: A0A3Q2GDR4
LinkDB
Position
Unknown
AA seq 253 aa
MRKKIISTTCVLWGLFSSFHLCSGKFGTPITDDVNKLSVLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLASMFGSMSSNKDNIIVFIAMLKSLRFTFEHEELETAMQVFQ
CHYQEKSLLSGLYFDYIQDLLHVATHGTSTLSCKPPPCLNHQQTPEGQEKSRKHSWLKRS
PLLLVIIPFIACVVLIVWQVKSRRRLLACSTSNGQTASPDMIPTVSVSIPLQTVTHAADS
QPTGEAVSEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcatcagcacaacttgtgtcctctggggtcttttttcaagtttccat
ctctgttctgggaaatttggaacgccaatcactgatgatgtgaacaagctgtccgtgttg
aagcagaatatcccctctgattatgagattcctgttagttatattcccaaagaggtggcc
ggcacgtgctgggtggttctaaatatctatcctttggagcaaagtcttcgaaagctggcc
agtatgtttggttccatgtcttccaacaaagataacataattgtcttcattgcaatgctg
aagagtttacgcttcacctttgaacacgaagagctggaaacagcaatgcaagtcttccag
tgtcactaccaagaaaagagcttactttctggactttactttgactacatccaagacctc
ttacatgttgcaacgcatggaacatcaaccttatcatgcaagccaccaccttgccttaat
catcaacaaacaccagaaggtcaggagaagagtcgtaaacacagctggttaaagagaagc
cccttgcttttggtgataataccgttcatagcctgtgttgtgctgatagtttggcaggtg
aagtctaggagaaggctgctggcgtgcagcacttcaaacggccaaaccgcatctcctgat
atgatcccaactgtgtctgtctccatcccacttcaaacagtcacccacgccgctgacagc
cagccaacgggggaggcagtttctgaacatgagagtggatga

DBGET integrated database retrieval system