KEGG   Cyprinodon variegatus (sheepshead minnow): 107088990Help
Entry
107088990         CDS       T06110                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00590  Arachidonic acid metabolism
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107088990
Enzymes [BR:cvg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107088990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 107088990
NCBI-ProteinID: XP_015236975
Ensembl: ENSCVAG00000022549
UniProt: A0A3Q2DKI8
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MRACVLGSICALLMLLWEPGCQGDEVTTSTVNPCCYLPCQHWSVCVRHGQDKYECDCTHT
GYYGQNCTIPELWTRVRQFLKPSPDVVHYILTHFHWLWDIINNTFLRDTLMRLVLTVRSN
LIPSPPTFNSKYGYLSWESYYNLSYYTRILPPVPEDCPTPLGVKGRNGLPDPEVLVERLL
KRRTFRPDPQGSNLMFAFFAQHFTHQFFKTYNSMGVGFTKALSHGVDAGHIYGDNLRRQH
KLRLFKDGKMKYQIINGEMYPPTIADAPVKMSYPPGIPAERQMAIGQEVFGLLPGLGLYA
TLWLREHNRVCDVLKAEHPTWDDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYLLKLKFD
PSLLFQSQFQYGNRISLEFSQLYHWHPLMPDSFHINGDELSYSQFLFNTSVLTHYGVEKL
VDAFSRQPAGQIGGGYNMNSVVTNVAVRTIKESRQLRVQPFNEYRKRFNLEPYTSFRDFT
DNEEIASTLEELYGDIDALEFYPGLLLEKTRPGAIFGQSMVEMGAPFSLKGLLGNPICSP
EYWKPSTFGGKVGFDIVNSATLKKLVCLNSRTCPYVAFRVPAEEKPDRNDGRERSNEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttgtgttcttggatcaatttgtgctcttctcatgctcctgtgggagcctgga
tgccagggggatgaggttacaaccagcacagtgaacccatgctgttatctgccctgtcaa
cactggagtgtttgtgtgcgccacggccaggacaagtacgaatgtgactgcactcacact
ggctactacggacaaaactgcacaatcccggaattatggacccgggtgcgtcagttcctc
aagcctagtccagatgtagtgcactacattctcacccacttccactggctctgggacatt
atcaacaacacgttcttacgggacaccctcatgcgtctggttctaacagtgaggtccaac
ttgattcccagtcctcccactttcaattcaaaatatggctacctcagctgggagtcctac
tacaacctcagctactacaccaggatcctgccgcctgttcctgaggactgccccacgcct
ctgggcgtcaaaggcagaaatgggctccctgaccccgaggtgttggttgagaggctgctg
aaaagaaggacattcagacccgaccctcagggctccaatcttatgtttgctttcttcgct
cagcacttcacccaccagttcttcaagacatacaatagcatgggtgtgggcttcactaag
gctttatcgcatggggtcgacgcggggcacatttatggagacaacttgcgacgtcagcac
aagctcaggctttttaaagatggaaaaatgaaatatcagataatcaatggagaaatgtac
ccccccaccatagctgatgctcctgtgaagatgagctaccctcctgggatccctgcagag
agacagatggccattggtcaggaggtgttcgggctcctccctggtttggggttgtatgcc
acgctgtggcttagagagcataacagagtctgtgacgtcctgaaagcagagcacccaacc
tgggatgacgagcagctcttccagaccacccgcctcatcatcataggtgagaccatacga
atcgtcatagaggattacgtgcagcacctcagcggctacctactgaagctcaagtttgat
ccctccctgctgtttcagtcccagtttcagtacgggaaccggatctcgctggaattcagc
cagctctatcactggcaccccctgatgcctgacagcttccacattaacggggacgaactg
tcgtactcgcagttcctcttcaacacatctgtcctcacacactatggcgtggagaagctg
gtggatgccttctcacggcaacctgctggccagatcggtggaggctacaacatgaactct
gttgtcaccaatgttgccgtgcgaacaataaaggagtcgcgccagcttcgggtccagcct
tttaatgagtacaggaagcgttttaacctggagccgtacacgtcgttcagagacttcacc
gataacgaggagatagccagcactcttgaagagctttatggtgatattgacgctcttgaa
ttttatcctgggttactgctggagaagactcgaccgggggccatctttggacaaagcatg
gtggaaatgggtgctccgttttccctcaaaggcctcctgggaaaccccatatgttctcca
gaatactggaagcccagcacatttggaggcaaagtcggcttcgacatcgtaaactctgcc
actctgaagaagctggtgtgcctgaactccaggacgtgcccctatgtggcgttcagagtt
ccagcagaggagaaaccagataggaacgatgggagagaacgaagcaatgagctatga

DBGET integrated database retrieval system