KEGG   Cyprinodon variegatus (sheepshead minnow): 107089354
Entry
107089354         CDS       T06110                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Cut8 Ras_bdg_2
Other DBs
NCBI-GeneID: 107089354
NCBI-ProteinID: XP_015237580
Ensembl: ENSCVAG00000006359
UniProt: A0A3Q2CIR2
LinkDB
Position
Unknown
AA seq 366 aa
MMSWGEFIELRDLNSSSGQMELTGLRSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVL
SSSQDPEFVEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRAL
IQLDCSWERGSAADLTTVVEHTIETDTNVDEQVEHGKPEWTTAEILQKVKEYNSQINSNL
FMNMNKDGSYTGFVKVQFKLARPVSVPAPKKGGPDAGGRRASGVKRRTSFYLPKDASKHL
HISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYLRKLSDGERPLRLRLNAGP
NEKVLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVKRYTLARTKMLEAL
SGSTPG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgatgtcttggggggagtttatcgagctccgtgacctgaactctagcagtgggcagatg
gaactgactggcctgcgttcgccatgctcacccccgcgcctggagagaaccaacgccttg
aggatcagcccagggaaggtgcccgacctcctgagccgcgtgggcatcatcagggttctc
agcagctcccaggaccccgagtttgtagaagagaagggagaggggcataacttccaaccc
tgcagccatgctcagcctacgtggtgcgacctgtgtggtgacttcatttggggcctttac
aagcagagtctgcggtgtgtcaactgcaggtttacatgccactaccgctgccgtgccctg
attcagctggactgcagctgggagcgtggctcggcggcggacctcacaactgttgtggag
cacaccatagagacagacacgaatgtggacgaacaagtcgaacatgggaaaccagaatgg
actactgctgaaattctgcagaaagtgaaggaatacaactcccagatcaatagcaatctg
ttcatgaacatgaacaaggatgggtcctacactggttttgtgaaggtacaattcaagcta
gcacggcctgtgtcagttccagcaccaaagaaaggaggtcctgatgctggagggaggcga
gccagcggagtgaagcgccgcacctccttctacctgccaaaggatgcctccaagcatttg
cacataagctcccgtacgtctgctcgtgaggtcattgaggctttgttgaagaagttcaca
gtggtggacaatcccggcaaatttgcactgtttgagcgcagcgagcgccatgaccaagtt
tatcttcgtaagctctctgatggcgaacggccgctccgtttacgtctgaatgcggggccc
aatgagaaggtcctcagttttgttctcaaagaaaatgaaactggtgaagttaattggcac
gctttctccatgcctgagctgaagaacttcctgctcatccttcagcgtgaagaagaggaa
cacgtcaagcagattgtgaaaagatatactttggctcgcaccaagatgctggaggctttg
tccggctcaaccccaggctga

DBGET integrated database retrieval system