KEGG   Cyprinodon variegatus (sheepshead minnow): 107089514Help
Entry
107089514         CDS       T06110                                 

Gene name
polh
Definition
(RefSeq) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107089514 (polh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107089514 (polh)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107089514 (polh)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    107089514 (polh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS zf_UBZ IMS_C IMS_HHH RXT2_N
Motif
Other DBs
NCBI-GeneID: 107089514
NCBI-ProteinID: XP_015237881
LinkDB All DBs
Position
Unknown
AA seq 709 aa AA seqDB search
MDYGKERVVALVDMDCFYVQVEQRLNPALKNTPCVVAQYKTWKGGSIIAVSYEARAHGVT
RNMWVDDAKKLCPDLQVARVRESHGKADLTHYREASVEVIEVMSRFAVIERASIDEAYMD
LTAAVQERRKKMTDQQIDPSLLRTTYIQGYPQSDLEPFMGDDSNQVDDPVLNKEQRRSRG
VEQWLASLPAPSTGGQSSAELQLTVGALIVEEMRAAVEKHTGFRCSAGISHNKVLAKLAC
GLNKPNRQTVVPLDSVTELFSTLPIEKIRNLGGKMGASIKEALGVDNMGDLTQFSQAQLG
QHFGEKTGQWLYDLCRGIEFEAVKPRQLPKSIGCSKNFPGKTSLATKEQVQYWLHQLALE
LEERLTKDREANGRVAKLLTVGVRQLGDKRPSSFSRCCALVRYEATKISSDSFAIIKSLN
TAGNHQAAWTPPLTLLHISASKFSDAPSTGGIAGFLSSDVSSTQSLLSATQTPSQPQGSL
CSQPGTIQSFFQKATGKEKQAREDKEEDNNCESSKEGSSPESTLNLKIILEKPRSGISSF
FQKKSLERSFKSPALPPTSESEPEIIPLDHNKDLEAVTEYKPHQLQFDDARMKTEKPEEN
TQPTSVLEEDLTTCERCHKQVLVWEMPEHNDYHFALDLQNSLSSSSNSVASSSTSSSLSD
ALLTPLRAGVSAQSSRGKTKTRGQSGPAPKRQRSQGQSTGTLDSFFKKN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggactacgggaaggagagagtggtggcgttagtcgacatggactgtttttatgtccag
gttgaacagcgactgaatccagctctgaagaacacaccttgcgtggttgctcaatacaag
acgtggaagggaggcagtatcatagctgtgagctatgaggctagggcccacggtgtcacc
aggaacatgtgggtggatgatgccaaaaagctgtgcccagatctccaggtggccagagtg
cgtgagtctcatgggaaggcagatctaactcattacagagaagcaagtgtggaggtgatc
gaggtgatgtctcgttttgctgtgattgagagggccagcattgatgaggcctacatggac
ttgacagcagctgtccaggagaggaggaaaaaaatgacagatcaacagattgacccgtcc
cttctcaggactacctatattcaaggctatccacaaagtgacctggaaccatttatgggg
gacgactccaaccaagttgatgaccctgtcttgaataaagagcagagaagatccagaggg
gttgagcagtggttggcgtccttacctgctccgtccacaggagggcagagctcggcagag
ctgcagctaaccgtaggtgcgctcattgttgaagaaatgagagcagctgttgagaaacac
acaggcttccgatgctcagcaggaatatcacacaacaaggttttggctaaactggcctgc
ggtcttaacaaacctaacagacaaacggttgtacctttggactcggtgactgaactgttt
agcactctgcctatcgaaaagatccgtaacctggggggcaagatgggtgcgtcaataaaa
gaagctctgggagttgacaacatgggagacctcactcagttttctcaagctcagctgggg
cagcactttggagaaaaaacaggccagtggctgtatgacctgtgtcgggggattgagttt
gaagctgtgaaacccagacagctccctaaatccatcggctgcagtaagaacttccctgga
aaaacatcacttgctacaaaagagcaggtgcagtattggcttcatcaactggcccttgag
ttggaggagagactgaccaaagacagagaagctaacggtcgagtggcaaaattattgaca
gtaggcgtacgtcagcttggtgataagaggcccagcagcttctctcgatgttgcgctttg
gtgcgctatgaggcgaccaaaatatccagtgacagctttgccattatcaagagtctaaac
acagcaggaaaccatcaggctgcatggacgccgcctctaactttgctccacatctcggct
agtaaattcagcgatgctccatccactggggggatcgctggctttctgtccagtgatgtc
agctcaactcagagcctgctctctgctactcagaccccctctcaaccacaggggtctttg
tgcagtcagcctggaactatacagtccttctttcaaaaagccactgggaaggaaaaacaa
gctagagaggataaagaagaagacaataactgtgaaagctcaaaagagggatcttcccct
gagagtactttaaacctcaaaatcattttggagaaaccccgttctggcatatcttcattc
tttcaaaagaagagcctcgaaagaagctttaaatcacctgccttaccgccaacgtctgaa
tcagaacctgaaatcatacctttagaccacaataaagacttagaagctgtcacagagtat
aaaccacatcagctacaatttgacgatgcaaggatgaaaacagagaaaccagaagaaaat
acccaacctaccagcgtgcttgaagaagatcttacaacttgtgaacgttgtcataaacaa
gtactagtctgggaaatgcctgaacacaatgattatcactttgccttggaccttcaaaat
tcactgtcttcatccagtaattcagtagcttcctcttccacctcctcctctttgtcagat
gcgttgctgactcctcttagagcaggagtctcagcacagtcttcacggggcaaaacaaaa
accagaggccagtcaggccctgctccaaaaagacagcgctcccaaggacaaagtaccggc
actctggattcattttttaaaaagaactga

DBGET integrated database retrieval system