KEGG   Cyprinodon variegatus (sheepshead minnow): 107089939
Entry
107089939         CDS       T06110                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107089939
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107089939
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cvg04052]
    107089939
   00536 Glycosaminoglycan binding proteins [BR:cvg00536]
    107089939
Cytokines and growth factors [BR:cvg04052]
 Growth factors
  Growth factors (RTK binding)
   107089939
Glycosaminoglycan binding proteins [BR:cvg00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107089939
SSDB
Motif
Pfam: FGF Fascin US22
Other DBs
NCBI-GeneID: 107089939
NCBI-ProteinID: XP_015238491
Ensembl: ENSCVAG00000008924
LinkDB
Position
Unknown
AA seq 182 aa
MARLCLPSCLSPPGLDDERSGSAVSLQSQELRSSGMSVGDVTVLPSGSLSQGQRSLTRLY
CQNGGHHLRILSDGTVNGGRQENDTYEILRLKAVRVGVVVIKGEMTGRYLAMNKNGNLYG
SQALNDECYFLEKYEENNYNTYCSQKYSWYVALKRNGQPKRGPDTHQGQKAICFLPRPTG
SG
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgcgtttatgcctcccttcatgtctcagtcctccaggccttgatgatgagcgtagt
ggctctgctgtgtctttacagagccaagaacttcgctcgtctgggatgtctgtgggggat
gtgacggtgctcccatccggctccctgagccaggggcagcgttcgctgaccaggctctac
tgtcagaatggagggcatcacctgaggattttatccgatgggacggtgaatggtgggagg
caggaaaatgacacttatgaaatcctgagactgaaggcggtgagagtgggagtggtggtg
atcaaaggggagatgacaggaaggtatctggccatgaacaaaaacggaaacctttatgga
tcacaagcactaaatgatgagtgctactttttggaaaaatatgaagagaacaactacaac
acatactgctcccagaaatacagctggtatgttgctttaaagaggaacggccagcctaaa
agaggaccggacacccaccagggtcagaaggccatttgcttcctgcccagacccacaggc
agcgggtaa

DBGET integrated database retrieval system