KEGG   Cyprinodon variegatus (sheepshead minnow): 107090067
Entry
107090067         CDS       T06110                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04080  Neuroactive ligand-receptor interaction
cvg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107090067
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107090067
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cvg04030]
    107090067
G protein-coupled receptors [BR:cvg04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107090067
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv DUF1634
Other DBs
NCBI-GeneID: 107090067
NCBI-ProteinID: XP_015238714
Ensembl: ENSCVAG00000006138
UniProt: A0A3Q2DTC6
LinkDB
Position
Unknown
AA seq 353 aa
MSSNTTECYYNQNVSFFYEQTGKNISVNWRKRDYAVVTLGLTVCFIVIFSNLLVIAAIFK
NRRFHFPIYYLLGNLALSDLFSGISYLHLMFHTGPWTIKLSQYQWFVRQGLIDTSLTASV
LNLLAVAAERHQTIFNMQLHSKMSTRRVIIVILFIWMVAIIMGLFPTMGWNCVCDLESCS
TMAPLYSRSFLIFWAVLNLVTFSIMVAIYTRIFLYVRHKSKQMSEHTTQTRHKETVLGLM
KTVSMILGLFVLCWTPGLVLLMLDGFDCISCKVLRYEKYFLVLAECNSFVNPIIYCFRDK
DMRRTFKELLCCLCNRNRGQTTRDNHFTTLENSRLRTIRKETDSNRSSLMNDD
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtcttcaaataccactgaatgctactataatcaaaatgtcagttttttttatgaacag
accggaaagaacataagtgtcaattggcggaaacgtgattatgcagtggtcactttgggc
ttgactgtttgcttcatagttattttttcaaaccttttggtaatagcagccatttttaaa
aaccgacgttttcacttccccatctactacctgctgggtaatctggccctctcagacctc
ttctcaggtatctcctatctccacttgatgtttcacactggtccctggaccattaagcta
tctcagtaccaatggtttgttcggcaggggcttatcgacaccagcctaacagcctctgtc
ctcaacctgcttgctgtagctgcagaaagacaccagactatttttaacatgcagctgcac
agtaagatgagcacacggagggttataatcgtcatattattcatctggatggtggcaatc
attatgggtcttttcccaaccatgggatggaactgtgtgtgcgacctggaaagttgctcc
acaatggcgccgctctacagccgtagcttcctgatattttgggctgttcttaacttagtg
actttctccataatggtggctatctacactaggatcttcctctacgtaaggcacaaaagc
aagcagatgtcagagcacacaacccagacaaggcacaaagagaccgtactcggcttgatg
aagaccgtttcaatgatccttggcctgtttgtgctctgctggacaccaggtcttgttcta
ctgatgcttgacggttttgactgtatatcgtgtaaagtgctgcgctacgagaagtacttc
ctggtgttagccgagtgcaactctttcgtcaaccccatcatctactgcttcagggacaaa
gacatgaggaggaccttcaaggagctgctgtgctgtttgtgcaaccggaatcgcggccag
acaacacgagacaatcactttaccacccttgagaactcgagacttcgcaccatcaggaag
gaaacggatagcaaccggtcttctctcatgaatgatgactaa

DBGET integrated database retrieval system