KEGG   Cyprinodon variegatus (sheepshead minnow): 107090599Help
Entry
107090599         CDS       T06110                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00040  Pentose and glucuronate interconversions
cvg00051  Fructose and mannose metabolism
cvg01100  Metabolic pathways
Module
cvg_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107090599 (sord)
   00051 Fructose and mannose metabolism
    107090599 (sord)
Enzymes [BR:cvg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107090599 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 107090599
NCBI-ProteinID: XP_015239556
Ensembl: ENSCVAG00000017492
UniProt: A0A3Q2EBA6
LinkDB All DBs
Position
Unknown
AA seq 354 aa AA seqDB search
MAQENLSVVLHAKGDLRLENRPVPEPGPNEVLLQMHSVGICGSDVHYWQHGRIGDFVLQK
PMVLGHEAAGRVVKVGSAVTHLKPGDRVAIEPGVPREMDEFFKRGKYNLSPTIFFCATPP
DDGNLCRYYTHNANFCYKLPDSVSFEEGALIEPLSVGIHACRRAGVSLGSTVLICGAGPI
GLVSLLVAKAMGASKVIITDLFKERLEMAKELGADFQLTVKKDDGPQELAKKVEEILGAQ
PEITIECTGVESCIQTALYATRSGGVVVLVGLGAPMTTVPLVNAAVREVDIRGVFRYCNT
WPMAIAMLSSGKVNVKPLVTHRFPLEQAVQAFETTRQGLGIKVMLKCDKNDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggaaaatttgtccgtggtgttgcatgctaaaggagacctcaggctggaaaat
cgtccagttccagagccaggacctaatgaagtgctgcttcagatgcactcagtgggaatc
tgtggatcagatgtccactactggcagcatggccgaatcggggactttgttctccagaaa
cccatggtcctggggcacgaggctgcagggagggtggtgaaggtcggatcagcggtcaca
caccttaaaccaggtgacagagtggccattgagcctggggtaccccgagagatggatgag
ttttttaaaagaggaaaatataacctgtcccccaccatcttcttctgcgccacaccgcca
gatgatggaaacttgtgcagatattacacccacaatgccaatttttgctacaagttgcct
gatagtgtctcattcgaggagggtgcactcatcgagccactctctgtgggaattcatgcc
tgtcgccgggctggggtcagccttggcagtaccgtactcatctgtggtgcaggacccatt
ggattggttagcttgcttgtagccaaggcaatgggggcttcaaaagtcatcatcactgat
ttgttcaaagagcgcctggagatggccaaggaactaggtgcagacttccagctgacagtg
aaaaaagatgacggaccccaggagctggcaaagaaagtggaggaaatcctgggagctcag
cctgagatcaccattgaatgcactggagtggagagctgcattcaaactgccctttatgca
acgcgctcaggaggtgtagtggtgctggtgggcctcggtgctccgatgactaccgttcct
ctcgtcaacgctgctgtaagagaagtggacatcagaggagtgtttcgctactgcaacacc
tggccgatggctatcgctatgttgtcatccggtaaagtaaatgtgaagcctcttgtgacc
caccgctttccactggagcaggctgtgcaggcatttgagaccacgcgacagggtcttggg
ataaaggtcatgttaaagtgtgataaaaatgaccagaacccatga

DBGET integrated database retrieval system