KEGG   Cyprinodon variegatus (sheepshead minnow): 107090969Help
Entry
107090969         CDS       T06110                                 

Definition
(RefSeq) monocarboxylate transporter 8-like
  KO
K08231  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cvg02000]
    107090969
Transporters [BR:cvg02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   107090969
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    107090969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 107090969
NCBI-ProteinID: XP_015240124
Ensembl: ENSCVAG00000011965
UniProt: A0A3Q2CVV7
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MGINGLEAQPSTDMSRAELEVDGSKDDQPAGSESKIAKEESSVQLIEGEFKPDAEAGAKL
EMHGQGAGFVPPEGGWGWLVVFAATWCNGSIFGIQNSFGILHTMLLEEHKDPNGQTSQFK
VALVGALAMGMIFFCSPVVSMFTDRFGCRKTAVCGAAVAFIGLLSTSFANSLILRYFTYG
ILFGCGSSFAFQPSLVILGHYFRQRLGLANGVVTAGASLFSMGLPVFLKKLVEPLGLSRT
FQILSLLMLVQALLALTFKPLLPTRGGMGPPGMDPGPAESQTQATAQGMSKWSKAVAGVR
KYFNLRVFHIVTYRVWAFGVATAVLGYFVPYVHLIKFVKENFKENEKEWVLLVCIGASSG
VGRLGFGKIGDLIPGLWKIYMQVISFIALGLMSMMIPQCSVFEALVVVCVFLGLCDGCFL
TMMAPIAFELVGPMQASQAIGYLLGLMSLPMMAGPPIAGLLHGYFGNYTVAFSLAGVPPM
VGGVVLFFVPLIHRRIQRKQASPEEISTTTHMLPTAPPIGEPKSCSNGDILPGYTDVETH
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggggatcaacgggttagaggcgcagccgtccaccgacatgtcccgggcggagctggag
gtggatgggagcaaggatgatcaaccagcgggaagcgagagcaaaatcgccaaggaggag
agttccgtccagctgatcgagggggagttcaagcctgatgctgaagctggagcaaagctg
gagatgcacggtcagggagccgggtttgtcccgccagagggaggctggggctggcttgtg
gtttttgctgcaacctggtgcaacgggtccatattcgggattcaaaactcttttggtatt
cttcatacgatgctgttggaggaacacaaagacccaaatggccaaacttctcagttcaaa
gtggccttggtcggggcccttgccatggggatgatcttcttctgctctcctgtggtcagc
atgttcacagaccgcttcggctgcaggaagaccgccgtctgcggggcagcagtggctttt
atagggcttctcagtacatcatttgcaaactccctaatcctccgctacttcacatacggg
atactgttcggctgtggctcctccttcgccttccagccgtccttagtaatcctcggacac
tactttcggcagcggctgggcttggccaacggcgtggtcacggccggagccagcctcttc
tctatgggactgcctgtgtttctgaaaaagctggtcgaacctctgggtctaagcagaacc
ttccagattctcagcctcttaatgctggtgcaggcccttctagcattaacattcaaaccc
ttgctccccaccaggggaggcatgggccccccagggatggacccgggccctgctgaatcc
cagacccaggctacggctcaggggatgagcaagtggagcaaggcggttgctggggttagg
aaatacttcaacctgcgtgtgtttcacattgtgacctaccgtgtttgggcatttggagta
gcaaccgctgtgctaggatactttgtgccatatgtccatctgataaagtttgtgaaggag
aatttcaaggagaatgaaaaggaatgggtgcttctcgtctgcatcggagcttcatcgggg
gtgggacggctcggctttgggaagattggagaccttattcctggtctgtggaagatctac
atgcaggtcatttccttcatagctctgggcctgatgtccatgatgattcctcagtgctcg
gtgttcgaggcgctggtggtggtgtgtgtgttcctggggctctgtgatggctgctttctc
accatgatggctcccatcgccttcgagctggtcggtcccatgcaggcctcacaagccata
ggttaccttctgggccttatgtcccttcccatgatggcgggtccacccattgcaggtctt
cttcatggctacttcggtaactacacagtagcgttctccctggctggggtacctcctatg
gttgggggcgtggtgctgttctttgtgcccctgatccaccgcaggatccagcggaagcag
gcatcgcccgaggaaatatctacgactacccacatgctgcccaccgccccacctattggg
gaacccaagagttgctccaatggagacatcctgcctggttataccgacgtagagacgcac
atctga

DBGET integrated database retrieval system