KEGG   Cyprinodon variegatus (sheepshead minnow): 107091563
Entry
107091563         CDS       T06110                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04020  Calcium signaling pathway
cvg04144  Endocytosis
cvg04510  Focal adhesion
cvg04540  Gap junction
cvg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107091563 (pdgfra)
   04020 Calcium signaling pathway
    107091563 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107091563 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107091563 (pdgfra)
   04540 Gap junction
    107091563 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107091563 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107091563 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cvg04090]
    107091563 (pdgfra)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107091563 (pdgfra)
Protein kinases [BR:cvg01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107091563 (pdgfra)
CD molecules [BR:cvg04090]
 Proteins
  107091563 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 Ig_5 C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 107091563
NCBI-ProteinID: XP_015241041
Ensembl: ENSCVAG00000010913
UniProt: A0A3Q2CTJ4
LinkDB
Position
Unknown
AA seq 1448 aa
MDGMKIYLVCGVICVGMVSAMADLFSSMGMEEPTRELEPNSLINVSCSADSEIVWDAPVL
KDAIITSDGFTSTLLIYNATVNHTGYYECKYGSEQTDIYIYVKDPSILFVPDGPEDWVDE
GDDGLVACRTSQLTYHVELIKIPSKEKIPGFYDPRMGFIGVSPGKYQCEATLDGRTFTSA
IYTVREKKPSEANDFEIKVSASEEMIRVGQPLNISCIIPLGPSFHQQWIYLKTQAVNAFR
TELTLMDKVIHTLSIPQATVQDGGSYECSVRNEASGKAKAGRVAVTVFEDNSFLTLDPRG
ILQTEFVTIFEETQFTIYINAYPTPKVSWMKDDQALTEDFYIFTKFSRIEGNRYQSTITF
RVPMEKDNGNYTITAISGTQTAHFSFILKMTATRLDIRPSSAPLLQPDLEEMVVPLHSSF
TLTCRGGTKLVWDTPFHRVEQSQVDRGVFVSTITVDIATLMHTGYYTCQYSGNITEEAEA
SSIYIYVPDPDSPFLPAYIYHLPPERSDVEIPCRVSDPSAIVTLVNVDTNQPVPCMYDSK
QGALGTFSAGTYVCKAIINGEVHTSEEYIVQDSIDMLQVKLYAERTALLVGETITVNCLA
QGPYLLEDNWKYPGKLANRGTKTVRESRKDREILYTLTIPHASTKDSGNYSCSITTVASR
ETQTKEIAIQVFAGEFLTINPDFQHHESARLDEVRELSATISSFPDAHVTWFKDGIPLND
VTAEFSTNLQKTSETSYRSVLTLIRVREEDSGNYTMRVENGNQSHEVSLHLVVKVPAVIV
DLMDLHHGSATGQSAVCITRGQPTPVVEWFICKNIKQCANDTSSWAPLPTNSTEITMESH
LDEKSNLEAQVMFGHLESTLSVRCFTKNELGVDSREIKLVSTGPHPELTVAAAVLVLLVI
VIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFPRDRLVLGR
ILGSGAFGKVVEGTAYGLSCSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNI
VNLLGACTKSGPIYIITEYCFHGDLVNYLHKNRESFLSLSPEKNKKELDIFGINPADENS
RSYVILSFESRGDYMDMKQADNTQYVPMLEMSTNSKYTDIHGPNYDHPPSQKGSGESEMD
NLLSDDTSEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGL
ARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTSLSDVWSYGILLWEIFTLGGTPYPGM
VVDSSFYNKIKSGYRMSKPEHAPQDVYEMMMKCWNSEPEKRPSFMGLSENMASLLPSSYK
RHYEKVNLEFLKSDHPAVTRVCMETDSGYVDIPYKNQGKLKDRESGFDEQRLSSDSGYII
PLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITLLDEMCLDCN
DLVEDSFL
NT seq 4347 nt   +upstreamnt  +downstreamnt
atggatgggatgaagatatacctggtgtgtggtgttatctgtgtgggaatggtctcagcg
atggctgatctgttctcatccatggggatggaagaaccaacccgtgagctggagcctaat
tccctcatcaacgtcagctgctcggctgactcggaaatagtttgggatgcaccagttctg
aaagatgccataattacttctgacggtttcacctcaactctcctaatttacaacgctact
gtaaatcacaccggctattatgaatgcaaatatgggagcgaacagacggatatctatata
tatgtcaaagatccttccatcctgtttgtcccagatggaccagaagactgggttgatgag
ggggatgatggtctcgttgcgtgccgtacatcgcagctgacatatcatgttgaactgata
aaaatccccagtaaagagaaaatcccaggattttatgaccccagaatggggtttataggt
gtatctcctggcaagtatcagtgtgaagccacattagatggccggactttcacaagtgcc
atctacaccgtaagagaaaagaaacccagtgaggcgaatgactttgaaataaaggtcagt
gctagtgaagagatgataagagttgggcagcccttgaacatctcctgcatcatacccttg
ggcccatcctttcatcagcagtggatctatctcaaaacacaggctgtaaatgcattccgg
acagagttaactcttatggacaaggtcatccacactttgagtatcccacaagccacggtt
caggacggcggcagctatgagtgctcggtcaggaatgaggccagtggaaaagccaaagcg
ggcagagtggctgtaactgtgttcgaggataactcctttttaaccctggatcctagaggg
attctgcagacagagtttgtcacaatttttgaagagacacagttcacaatctacattaat
gcatacccaactcctaaagtttcatggatgaaagatgaccaagcactaacagaggacttt
tacattttcacaaaatttagtcgcattgaggggaatcggtatcagagcactataacattc
cgagtacctatggagaaggataatggaaattacacaataacagccataagtggcacacaa
actgctcacttctcatttattctcaaaatgacagctaccagacttgatatcagaccctcc
tccgccccccttctgcaaccagacctggaagaaatggttgttcccctccactcgtctttc
actttaacatgtcgtggaggcacaaaacttgtatgggacacaccattccatagggtggaa
caatcacaggtggaccgcggcgtttttgtctccaccataactgtggacatagcaacatta
atgcacactggttattacacttgccaatatagtggcaacatcacagaggaagccgaggca
agcagcatttacatctatgtaccagatccagactctcccttcctgccagcatacatatac
catctgccgcctgagcgaagtgatgttgagattccatgtagggtgtctgatcccagtgcc
atagtgacactggtcaatgttgacaccaaccaacctgtgccttgtatgtatgatagtaaa
cagggcgctttaggaacattttctgcaggaacttatgtatgcaaggccataataaatgga
gaggtgcacaccagtgaagagtacatcgtccaggattcaatagatatgttgcaagttaag
ctctatgccgaaagaactgctctgctcgttggagaaacaataactgtcaactgtctggct
caaggaccttacctactcgaagataactggaaataccctggcaaactggctaatcgtggt
acaaaaactgtacgagaaagcaggaaagatagagagattctgtacaccctgacgatccca
catgcctcaaccaaagacagcggcaactactcatgttccattactactgtggcgtctaga
gagacccagacaaaggaaatagctattcaagtttttgccggtgagtttttaacgatcaac
ccggactttcagcaccatgaatctgcaagactggatgaggtccgggagttaagcgctaca
atatcctcctttcccgatgcccatgttacttggttcaaggatggcattccactcaatgat
gtgaccgctgagttctccactaatctgcagaagacaagtgagacaagctacagaagcgtt
ctcaccctgatccgggtgagggaggaggacagtgggaactacaccatgcgagtggagaat
ggaaaccaaagccatgaagtcagcttacacctggtggttaaagtgccagcagtcattgtg
gatcttatggacctccaccatggttcagccacaggacaatcagcagtgtgcattaccagg
gggcaacccactcccgttgtagagtggttcatatgcaagaacattaaacaatgtgccaat
gacacgtcttcttgggcgcctctacccaccaactccacagagatcacgatggagtcgcac
ctggatgaaaagagcaatctggaggcccaagtgatgtttggtcatctggaaagcactctg
tcagtccgatgctttaccaagaatgaactgggtgtagatagcagggagatcaaactggtg
tccactggccctcaccctgagctgacggtagctgccgcagtgctggttctactggtcatt
gtcatcatctcactcattgtcttggttgttatctggaagcagaaaccacggtatgagatc
cgctggagggtcatagaatctgtgagtccggacggccatgagtacatctatgtagatccc
atgcagcttccctacgactccagatgggaatttccccgagatagacttgtgcttggtcgg
atcctgggctctggagcctttggaaaggtggttgaaggcaccgcctatggactcagctgt
tctcagcctgtaatgaaggtggcagtgaaaatgctgaaacccacagctcgctccagtgaa
aagcaggctctgatgtctgaactgaagatcatgactcaccttggaccccatctcaacatt
gtaaaccttttgggagcatgcaccaagtcaggccctatctacattatcactgagtactgc
ttccatggtgacctggtcaactatctacacaagaacagggagagcttcctcagcttgagt
cctgagaaaaacaagaaggagctggatatctttgggatcaatcctgcagatgagaacagc
aggagttatgtgattctgtcctttgagagcagaggagactacatggatatgaaacaggca
gacaacactcagtatgtaccaatgctggagatgagcacaaactccaagtacacagacatc
catggtccgaactacgaccaccctccatcacagaaaggctctggcgaatctgagatggac
aacctgctgtcggatgacacgagtgaaggtctcaccaccaccgacctgcttagttttacc
taccaggtggccaaaggaatggagtttcttgcttccaaaaattgtgtgcatcgggatctc
gcagccaggaacgtccttctctctcagggcaaaattgtcaagatctgtgactttgggctg
gccagagacatcatgcatgacaacaactatgtctctaaaggaagcacctttttgccagtg
aagtggatggcaccagaaagtatttttgacaacttatacaccagtcttagtgatgtttgg
tcatacggcatactcctctgggagatcttcacccttggtggcacaccgtaccctgggatg
gtggtagactccagtttctacaacaagatcaagagcggataccgaatgtcaaagcctgaa
catgcacctcaagatgtgtatgagatgatgatgaagtgctggaacagcgagccagagaaa
aggccttccttcatgggtctgagtgagaatatggcgtctttgctgccctccagctacaag
agacattacgagaaagtgaaccttgagttcctgaagagtgaccaccctgctgtcaccaga
gtatgcatggagactgactcaggctacgttgacataccgtacaagaaccagggcaagcta
aaggacagggaaagcggcttcgacgaacagcgactgagctcagacagtggctacattatt
cccctccccgatctggaccctatatccgatgacgagtatggaaaaaggaacagacacagc
tctcaaacatctgaggagagcgcaattgagactggctcaagtagctccacttatgctaag
cgtgagggtgagaccctggaggacatcactctgctggacgagatgtgtctggactgtaac
gatctggtggaggacagctttctgtga

DBGET integrated database retrieval system