KEGG   Cyprinodon variegatus (sheepshead minnow): 107091797
Entry
107091797         CDS       T06110                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04068  FoxO signaling pathway
cvg04217  Necroptosis
cvg04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107091797 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107091797 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107091797 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107091797 (stat3)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107091797 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 107091797
NCBI-ProteinID: XP_015241438
Ensembl: ENSCVAG00000023075
UniProt: A0A3Q2DJW0
LinkDB
Position
Unknown
AA seq 800 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
STTQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDIGGKTQIQSVEPYTKQQLSSMSFADIIMSYKI
MDATNILVSPLVYLYPDVTKEEAFGKYCRPEAAHEPEAAGDSTSTIQPYLKTKFICVTPK
MYIAELGAELNHFLKCPSVFMDLQDSELLGNGFPGTNSGNTSDLFLMSPHTLESLMPPEA
EANQGHLDSITLNMDVASPM
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtatctggagcaactctaccac
ctttatagcgacagcttccctatggagctacggcagttccttgccccgtggattgagagt
caggactgggcttatgctgccaacaaggaatcacatgccacactggtgttccacaacctc
ctcggtgaaatagaccagcagtatagccgttttctgcaggagaataatgtactctatcag
cacaacctacgcaggattaaacagcatctgcaaagtaaatatttggagaaaccgatggaa
attgcacgcattgttgcccgctgtttgtgggaggaacagagactgttgcagactgccacc
tctactacacaggatggccaagcagcccatcccactggaacagtagtgacagaaaagcag
cagatactggagcacaaccttcaggacatcagaaagcgcgtgcaggatatggaacagaag
atgaaaatgcttgaaaacctccaagatgattttgactttaactacaaaaccttgaaaagt
caaggggagttgtcccaggacctcaatggaaacagccaggcagctgctacaagacagaag
atggctcagcttgagcaaatgctgagtgccctggaccagctcaggaggcaaatcgtgaca
gaaatgggaggtcttctgacggctatggattatgtgcagaagaatctaactgatgaggaa
cttgcagattggaagagaagacaacaaattgcctgcattggaggtccacctaacatttgc
ctcgatcgccttgaaacatggatcacatccttggctgagtcccaactccagatccgtcaa
cagattaagaaactggaggagcttcaacagaaagtgtcctacaagggagaccccatcatt
cagcaccggccagctttggaggagaagatagtggacctgttcagaaacctcatgaagagc
gcctttgtggttgaaagacagccttgcatgcccatgcatccggacagaccgctggtcatc
aaaacaggagtgcagttcacaacaaaagtcaggttgcttgtaaagtttcctgaactcaat
taccaactgaagattaaagtttgcattgacaaggaatctggggatgtggctgcaattaga
gggtctcgaaagtttaatattctcggcacaaacacaaaagtcatgaacatggaggaatcc
aacaacggcagcctttcagcagagtttaaacacttgactctgcgagaacagaggtgtggc
aacggcggccggaccaacagtgatgcctctctcattgtaacagaggaactccatcttatc
acgtttgagacggaggtctatcaccagggccttaagatagatctagagactcattcgctg
ccagtggttgttatttcaaacatttgccagatgcccaacgcctgggcttctatcctgtgg
tacaacatgttaactaatcacccaaagaacgtgaacttcttcaccaagcctccggtggga
acgtgggaccaggtggctgaggtgttgagctggcagttctcttcaaccactaagagaggc
ctgaccattgagcagctgaccacgctggctgaaaaactacttgggccttgcgtaaactat
tccgggtgccaaataacatgggccaagttctgtaaggaaaacatggccggaaaaggtttc
tccttctgggtgtggctggacaacatcattgacctggtgaagaagtacatcctcgccctt
tggaatgaaggatacatcatgggttttatcagtaaggagagagagagagccattctgagt
ccaaagcctcctggcacatttcttctgcgcttcagtgagagcagcaaagagggcggcata
acatttacgtgggtagagaaagacattggaggaaagacccagatccagtccgtagagccg
tacacaaagcagcagctcagcagcatgtcgtttgcagacatcatcatgagttacaagatc
atggatgccaccaatatcttggtctcacctcttgtttatctctatcctgatgtaaccaaa
gaggaggctttcggaaaatactgcaggccggaggcggctcatgagcctgaggcggcagga
gactcgacgagcactatccagccatacctcaagactaaatttatctgtgtgaccccgaag
atgtacattgcagaacttggagctgaactgaatcacttcctaaagtgtccctccgtgttc
atggacttgcaagacagtgagctgcttgggaacggattcccaggcacaaattctggaaac
accagtgacctgttcctcatgtcgcctcacactctggagtctctgatgccgcctgaagct
gaagctaatcaaggccatttggattcaattactctgaacatggatgtagcatctcccatg
tga

DBGET integrated database retrieval system