KEGG   Cyprinodon variegatus (sheepshead minnow): 107091893Help
Entry
107091893         CDS       T06110                                 

Gene name
ercc1
Definition
(RefSeq) DNA excision repair protein ERCC-1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03420  Nucleotide excision repair
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    107091893 (ercc1)
   03460 Fanconi anemia pathway
    107091893 (ercc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107091893 (ercc1)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     107091893 (ercc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10 HHH_5 HHH HHH_2
Motif
Other DBs
NCBI-GeneID: 107091893
NCBI-ProteinID: XP_015241574
Ensembl: ENSCVAG00000019532
UniProt: A0A3Q2DC09
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MKRFHINLDDSAFTKERIPPKSQFQSKQNTSSPSTSTTEPIAKCSVQPLSYAEYIVQSKG
TAAAAPQRNVAPKQPMAGGAGVCSLQPKEPESVSSSTGGSEKTQDCDKRTEVQLEEGKKN
KDKLEPSERSCHKSDPSLIQGPKPVGSGSSIIVSPRQRGNPILKFVRSVPWEFGEVAPDY
ILGQTTCALFLSLRYHNLNPNYIHDRLKQLGNAFTLRVLLVQVDVKDPHHALKELARICI
MADCTLILAWSPEEAGRYLETYKSYEKKPADLLKEQVEKNYLSKVTDCLTTVKSVNKTDA
ITLLSTFSSVKGIIDASKEDLVLCPGLGPQKARRLYDVLHKPFLKSKTSNS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggtttcacatcaacctggacgattctgcgttcactaaagaaagaataccgcca
aagtctcagtttcagtcaaaacaaaacacaagctctccatcaacgtccaccacagagcca
attgctaaatgctctgtgcagcccctctcctatgcagagtacatcgtccagagtaaaggt
acagcagctgcagctccacagagaaatgttgcccccaaacagcccatggcaggaggagct
ggggtctgcagtctgcagccaaaggagccagaatctgtatcgtccagcactgggggctct
gaaaagacccaagactgtgataaaaggactgaagttcaactcgaggagggcaaaaagaat
aaggacaaactagagccatctgagaggagctgtcacaagtcagatccaagcctcatccag
ggtccaaaaccagtgggctctgggagcagcattattgtcagtcctcgacagaggggtaat
cccattctaaagtttgttaggagtgtcccctgggagtttggagaagttgcgcccgattac
atcctgggacagacaacttgtgctcttttccttagcctgaggtatcacaacctaaacccg
aactatatccatgaccgtttaaagcagcttggaaacgcattcaccttacgagtgttgctg
gttcaagtagatgtgaaagaccctcatcatgcactaaaggaattagctcgcatctgtatc
atggctgactgcactcttatcttggcttggagtccagaagaagcagggcgttaccttgaa
acatacaagtcatatgagaagaagccagcagaccttctgaaggagcaagtagaaaaaaac
tatctttcaaaggttacagattgcctgacaactgtgaaatctgtaaacaaaactgatgcc
ataaccttgctatccacattctcttcggtaaaaggaatcattgatgcctctaaagaagac
ttggttctctgtccaggcttgggaccacaaaaggcaagacgactttatgacgtcctccat
aagccttttctgaagtcaaagactagcaacagctga

DBGET integrated database retrieval system