KEGG   Cyprinodon variegatus (sheepshead minnow): 107092105Help
Entry
107092105         CDS       T06110                                 

Gene name
brca2
Definition
(RefSeq) breast cancer type 2 susceptibility protein isoform X1
  KO
K08775  breast cancer 2 susceptibility protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107092105 (brca2)
   03460 Fanconi anemia pathway
    107092105 (brca2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cvg04121]
    107092105 (brca2)
   03036 Chromosome and associated proteins [BR:cvg03036]
    107092105 (brca2)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107092105 (brca2)
Ubiquitin system [BR:cvg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    107092105 (brca2)
Chromosome and associated proteins [BR:cvg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107092105 (brca2)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     107092105 (brca2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     107092105 (brca2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Motif
Other DBs
NCBI-GeneID: 107092105
NCBI-ProteinID: XP_015241884
LinkDB All DBs
Position
Unknown
AA seq 3333 aa AA seqDB search
MDSSIKNMFDAFKDDIWKELGPVDPNWFEVLTAQASLGEGHVDDNDDLCANQEGLFKAPL
EKTAVESQLFSTPKVFRRSQMVSPETEDEPSFTAAQGKETPPWVTTQSPCLFEPTKQRVL
DVKCEGVQPQGEESFDLLDTPKKSPDSYVKHISESLGAQINPDISWTSSFNTPPAMPSTL
ILSKTEESPCPASVTADRNVVLVRKLFPSLSNSSLKTPKKSVGSSNSEGVVFPVAQHLPD
SPLDQSGSHWQQKDPDTVKGEVSGAVGLKNASSDFHFFANSSSALRKVKPDRVKCKQITL
TNEDACSHQAVSEADNGASSEEATTDLESGGLPATPLVKTGDSQWSPINLSEISSCAVSS
SMTQPGDIDSVQHSRPSLKVTDTGFIRKRRQFVYTVATKTSQIKCHDSQSQKMDSSTKIS
EYAQKATLKTLKNTTGKVECQKIQQCLGEPATYSAVPKLQDVDMSQLCREFAKEFSQMTD
LHIAEDAQSNFSPAACLTALKQAKQKVNQANPPNDISANKQVPTVYQPCSVSEGTMIDSR
VQSAVKDVTHMTTLSFGPPRSENFNQSRPSLSFKTDMHHLPSSNESGNPTINAEVSLHIS
TKDKNLDTGKGIDLHTESTSAGHSRSREETVDESNCSQLEKASIVPFANASGFKTASNKG
IHISPANLERGKRFFEEADGEKTSHDLSITTPYAKNNKRNLIPETTKPKPSNSNLLPKVE
RPFVNINSHLTASEKADVTELCCLLEEADSQFEFTQFKPAKNLPNREYDFHTSPRQDKDL
DPAFLQDIDFDDSFSSDCGKHPGVTVMNDNMALALSNGETAKGINLYTDLSMSNSLRENS
CLSENISETGKCPKLSDIFPRAEDTKASELKSNSTLMHGQGFKTAGGVMLQVSKKSLSRA
RALFAELENNLTEQKRADKQESKNVAQTEQKCDVDSDICKHNSFILKESCDVSNKSENCF
SNLDEVRCSNKNPSSVEDKNVLESSETDAAKCEIGKGISISAKHMKGADVLFKDCQVIEH
KEEKSTKAPPESVERGRSFSNFKSPKVNIYKEGFAGCSKFENENSALIAHTGGLHRDEVE
RNSMSTPALKNENGKKPFSTSKPSAILGTSKSIDLSASKDLCTSDGFRTAAGKNISVSVA
AMRNAASLLNQIDTPVETNKQPNQKKKTSETECLSNVMSKIDNGGFETVVEVRKFATLKK
PTLSKEHEKSEDKIGANQSKIPGNDPRSGGFFAASDEPGFLSSEALEKEKALFSDSSLNM
DDVSETVAVRIEKPETRLCSYTTAGGTKDQVSQKNLPKPKDQFEELDDLDLTKAVDEEGL
FSVFDEGNVRGSKQAELYNCYPGDKKKINISIKAGCSRGAEKQVEVKENILPQASHGLQA
ASGRKAGVSSHSLKRVESLCSEFEEIKNKTNATTPQFEATAPPLKNSVFHSVSGKPMAPS
AEEVEKPKSLFGNITRRAEDPDVSQTRKTDDIQDDQNKSKKICCGFTTARGKKVNVSQKN
LQKAKILLKEVSDLGLTKAMQDADILFRDDEDWTLDSNSDASLEQTNKVSTKESGSITGN
LSQLKPDKKQTVDVCEEPESSSIKANQKEGCSMPGQNGEFETASGKTVVVSCGALSRAKF
LSENNATTPQFKATAPPLKNSGFHSVSGKPMAPSAEEVEKPKSLFGNITRRAEVPDVSQT
RKTADKQDDQNKSKKICCGFTTARGEKVNVSQKNLQKAKILFKEVSDLGLTKAMQDADIL
FRDDEGWTLDSNSDASLEQTNKVSTKESGSLTGNLSQLKPDRKQTADFCEEPESGLNKAN
QKEGCSLPGQNGGFQTASGKTVIVSCEALSRAKLLSENNSTTLQFEATAPPLKNGGFHSV
RGKPMTPSAEEVEKPKSLFNITRRAEVPDVLQTRKTDDKQDDQNKSKKTFCGFTTARGEK
VNVSQKNLQKAKILFKEVSDLGLTKAMQDADISFRDDEGWILDGNSDASSEQTNKVSTKE
SGSITGNLSQLKPDRKQAAGICEEPESSSIKANQKEGCSMPGKNGGFQPASGNTVAISCE
ALLRPKLLSENKVDDDGICAPSQLSETPVSGPGLMNGGFFSASGKPVAISSEALQKAKAL
CSDISVTTALPYPTAQSKKEKMKCGLTNVGVTNVINSELSHVKYTEGTLNPISPPRSGNR
KNHSAVQSFPLAADIGSDHEEKPCMIVCDLDIKNSIKRSEVLTTGPEFQSLNLAGCTETQ
QMIFAQEAFDCTKALLDDEVRIGQSLLMGSEHFQIPEDCKSNGKSTEEAKRKKTRSAEDL
TAQPPSKRRLLEEFSETTDGPRGSGLHPIKSSPNGLMDRGVFKYNTSLHPHITKPHRDAK
SFVQSRYQRTTDTNPGDHTSASSKMQAFVPPFIKSAKRAVSNNPEVGDRKRVPVFVPPFK
KQRIVLQVSSPKQQGSDTNNDVTLTKKTPSSTDIVPLMKSSNTNVMIPSVPENEEPVGAA
ETSHVDNKLSRSQDRTENIMLARDMQDMRIRKKKRQTIRPLPGSLFLTKTSGVLRIPLKL
AVNGNKPTRCSAKELYECGVHKHVPEITGANAESFRFNLLQFIKQEMITDGGGVQLADGG
WLIPSNDWTAGKEEFYRALCDTPGVDPKLITEQWVYNHYRWIVWKQASMEKSFPEKMGSL
CLTPEQILLQLKYRYDVEVDHSRRPALKKIMERDDTPAKTLILCVCEIVSRGHLLNAQSR
SDTKTTQSAENNPSAIIWLTDGWYAIKAQLDEPLTAMLHKGRLAVGGKLMIHGAQLVGSQ
DACSPLEAPDSLMLKICANSTRRARWDAKLGFHKDPRPFLLPISCLFSNGGLVGCVDVLI
LRSYPMQWMERKSDGGVVFRSDRAEEKEARRFSHHKQKVMEMLFAKIQAEFEKEEEGRAK
PQRRRQTISKQDVANLQEGVELYEAVGDDPAYLEAHLSKKQMETLQAYRSSLMEKKQAEL
QDRYRRALDAEDNEMSCPKRDVAPVWRLCIADSKDQSSCVYKLNLWRPSSDLQSLLKEGC
RFKVYNLAVSDGKNRSTIETVQLTGTKKTQFQEMPASPEWLSSRFQPRVATDFADLQNEE
FKPLCGEVDLVGYVISVIDQQGPSPAFYLVDGKQNFVKVRCFTSLAQAGLEDVVKPGVLL
ALSNLQLRGQSMYPTPVVYAGDLTAFSTNPKEIHLQESLQQLKSLVQCQDNFCPSAEEKL
AQLVKSDGMQSVCSPSLQPQPAGSATDRRQSLSSNVTFQKPGKSLGSFTPVSSKLPAPTS
STEKDPKSLKRKRALDYLSRIPSPPPISPLGSVVSPCVKRTFNPPRRSGPPSTLKPAQTV
EPKRADSLVEDEWVNDEELAMIDTQELHVGNLL
NT seq 10002 nt NT seq  +upstreamnt  +downstreamnt
atggattcatccataaaaaacatgtttgacgcatttaaagatgacatttggaaagagctg
ggaccagtggatccaaactggtttgaggtactgacagcccaagcttctcttggtgaagga
cacgttgatgataacgatgacctgtgtgctaaccaagagggacttttcaaagcccctctg
gagaagacagcagtcgaaagccaactgttttcaacccctaaagtttttcgacgcagtcaa
atggtctcacctgagactgaagatgagccatcgttcacagccgcccagggaaaagaaacg
ccaccatgggtgacaactcagagtccctgtctgtttgagccaacaaaacagcgtgtcctg
gatgtaaaatgtgaaggtgtccaacctcagggtgaggagagttttgatcttcttgatacc
ccaaagaaatccccagacagctatgtcaagcatatttctgaaagtctcggtgcacagatc
aatccagatatctcttggaccagttctttcaataccccaccagcaatgccatctaccctg
attttatctaaaactgaagagagtccatgtccagcgagtgtcactgcagataggaatgtt
gttttggtccggaagcttttcccttcactttccaattcctcacttaaaaccccgaaaaag
agtgtagggtcttctaattctgaaggtgttgtttttcccgtggctcaacacctccctgac
tctccattggaccagagtggaagtcattggcaacagaaagatccagatactgttaaagga
gaagtttctggtgcagttgggttaaaaaatgcttcttctgacttccatttctttgcaaac
agtagctcagctctgagaaaggtgaaacctgacagagttaaatgtaagcaaataactctg
accaatgaagacgcttgcagccaccaggctgtatcagaagccgacaatggtgcatctagt
gaagaggctaccactgatttggaatctggaggattacctgcaaccccattagttaaaact
ggagatagccaatggtctcctataaatttatctgaaatctcatcttgtgctgtgagtagc
agtatgacacagccaggtgacattgattctgtccaacactcaagaccatcattgaaagtc
acagacactggatttattcgaaaaaggagacagtttgtttacactgttgcaacaaaaaca
tcgcaaattaagtgccacgactcacagtcccagaagatggattcctccacaaagatttca
gaatatgcacaaaaagcaactcttaagacattgaagaacaccacaggcaaagttgagtgt
cagaagattcaacaatgtctaggagaacccgcaacttactctgcagtcccaaaactccag
gatgttgatatgtctcaactttgcagagaatttgcaaaggagttcagccaaatgactgac
ctacatattgcagaggatgctcagagtaacttctctcctgcagcatgtctgactgccttg
aagcaagctaaacagaaagtaaatcaagcaaaccctcccaatgacatcagtgccaacaag
caagtccccactgtttaccaaccttgttcagtcagtgaaggcaccatgattgacagcaga
gtccagtctgctgtgaaagacgtcactcatatgaccaccttgtcatttggtcctcctcgt
tctgagaactttaaccaaagtcgaccgtctctgagctttaaaacggatatgcatcatttg
ccatcatcaaatgaaagtggaaatccaacgattaatgctgaagtgtctctgcacatatct
accaaagataaaaatctggatactggaaaaggaatcgatttgcacacagagagcacatca
gcagggcattcaaggagtagagaagaaactgttgatgaaagtaactgcagccagctggaa
aaagcttctattgttccatttgccaatgcatcaggattcaaaactgcttcaaataaaggc
atacacatttcccctgccaacctggagagaggaaaacgttttttcgaagaggctgatggt
gaaaagacttctcatgatcttagcatcactaccccatatgccaaaaataataaaaggaat
ttaattcctgaaacaacgaaacccaagccatctaattccaatctgttacccaaagtagaa
agaccatttgtaaatatcaattcccatttaacggcatcagaaaaagcggatgtgacagaa
ctttgctgtctcttagaggaggcggacagccagtttgaatttacacagttcaaacctgca
aaaaatctcccgaatcgtgaatatgatttccacacttcaccaagacaggacaaagatctt
gaccctgcttttctgcaagacatagactttgatgacagctttagttctgattgtggaaag
cacccaggagtcactgtcatgaatgacaatatggccctggctttatcaaatggagaaacg
gcaaaaggcataaatctatacacagacttgtctatgtcaaactcactaagggaaaactcc
tgtttgtcagaaaacatttctgagacggggaaatgcccaaagttaagtgatatctttccc
agagctgaggatactaaagccagcgagttgaagagcaacagtactttgatgcatggtcag
ggatttaagacagctggaggagttatgttgcaggtctctaaaaagagtctgagcagggca
agagctttgtttgcagagctggaaaataacttgacagagcagaaacgggctgataagcag
gaatcaaaaaatgttgcccaaacagaacagaaatgtgacgtggattctgacatctgcaag
cacaattctttcatcctcaaagaaagctgtgatgtaagtaacaaaagtgagaattgtttt
tccaatttagatgaggtccgctgttcaaacaaaaatccatcaagtgttgaagataagaat
gtccttgaaagcagtgaaactgacgcagcgaagtgtgaaatcgggaaaggaatctcaata
tcggctaagcacatgaagggtgcagatgtgttatttaaagactgtcaggtaatagagcat
aaagaggagaagagcacaaaggctcctccagaaagtgttgaaagagggagaagcttttca
aactttaaaagccctaaggtcaacatttataaggagggttttgctggatgctctaaattt
gaaaatgaaaattcagcattgattgcacatacaggtgggcttcatcgggatgaagtggaa
aggaacagcatgtctacaccagctttgaaaaatgaaaatggaaaaaagccattttcaact
tcaaagccatctgctattctaggcacatcaaagagcattgatttgtctgcctctaaagac
ctgtgcacaagtgacgggttccgtacagctgctgggaagaacattagtgtgtctgttgct
gcaatgaggaatgctgcatctcttttaaatcagatcgacacacctgtggagacaaacaaa
caacctaatcaaaagaaaaagacatcagaaacagaatgtcttagtaatgtgatgtcaaaa
atagataatggtggttttgaaactgtagttgaagtgagaaaatttgcaactttaaagaaa
cccacactgtcaaaagaacatgaaaaatcagaggataaaattggtgcaaatcagtccaaa
atcccaggaaatgacccgcggagtggtggcttttttgcagccagtgatgaacctggtttc
ttgtcatctgaggctttggaaaaggaaaaggctttatttagtgacagtagtttgaatatg
gatgatgtgtcagaaactgttgctgtaagaattgagaaaccagagacaagactctgcagt
tacacaactgcaggggggacaaaggaccaggtgtcacagaaaaatctcccaaaaccaaaa
gatcaatttgaagaacttgatgatctggatttaaccaaagcagtggatgaagaaggtttg
ttttcagtttttgatgagggaaatgtgcgggggagcaaacaggcagaattgtacaattgt
tatccaggtgacaaaaaaaagataaacatttctatcaaggctggatgttcaagaggtgca
gaaaaacaagtggaagtaaaggaaaacattttgccacaagcaagccatgggctacaggca
gccagtggaaggaaagccggtgtatcatctcactctctgaagagagtagaaagcctgtgt
agtgagtttgaagaaattaagaataaaacaaatgcaacaacaccacagttcgaggctact
gctcctccgctcaaaaatagtgtatttcactctgtcagtggtaaaccaatggcaccttca
gctgaggaggtcgaaaagccaaaatccctctttggtaatatcacccgcagagcagaagac
ccagatgtttcacagacaaggaaaactgatgacatacaagacgatcagaacaaatctaag
aaaatatgttgtggttttactacagcaaggggaaaaaaagtcaacgtttcccagaaaaat
cttcaaaaggcaaaaatccttttaaaagaagtcagtgacttgggtttaacaaaagcaatg
caagatgcagatattttgttcagagatgatgaagactggaccctggacagtaacagtgat
gcatcattagaacaaactaataaagtttcaactaaggaaagtggcagcataacgggaaac
ctgtcccaactcaaaccagataaaaagcaaactgtcgatgtttgtgaagaacctgaatcc
agttcaattaaagctaaccaaaaagaaggctgctcaatgccaggacagaatggtgaattt
gagacagcaagtgggaaaacagttgttgtttcatgtggggctctgtcaagagcaaagttt
ctgagtgaaaacaatgcaacaacaccgcagtttaaggctactgctcctccgctcaaaaat
agtggatttcattctgtcagtggtaaaccaatggcaccttcagctgaggaggttgaaaag
ccaaaatccctctttggtaatatcacccgcagagcagaagtcccggatgtttcacagaca
aggaaaactgctgacaaacaagacgatcagaacaaatctaagaaaatatgttgtggtttt
actacagcaaggggagaaaaagtcaacgtttcccagaaaaatcttcaaaaggcaaaaatc
cttttcaaagaagtcagtgacttgggtttaacaaaagcaatgcaagatgcagatattttg
ttcagagatgatgaaggctggaccctggacagtaacagtgacgcatcattagaacaaact
aataaagtatcaactaaggaaagtggcagcttaacgggaaacctgtcccaactcaaacca
gatagaaagcaaactgcagatttttgtgaagaacctgagtctggtttaaataaagctaac
caaaaggaaggctgctcattgccaggacaaaatggtggatttcagacagccagtgggaaa
acagttattgtttcatgtgaggctctgtcaagagcaaagcttctgagtgaaaacaattca
acaacactgcagttcgaggctactgctcctccgctcaaaaatggtggatttcattctgtc
cgtggtaaaccaatgacaccttcagctgaggaggttgaaaagccaaaatccctctttaat
atcacccgcagagcagaagtcccagatgttttacagacaaggaaaactgatgacaaacaa
gatgatcagaacaaatctaagaaaacattttgtggttttactacagcaaggggagaaaaa
gtcaatgtttcccagaaaaatcttcaaaaggcaaaaatccttttcaaagaagtcagtgac
ttgggtttaacaaaagcaatgcaagatgcagatatttcgttcagagatgatgaaggctgg
atcctggacggtaacagtgacgcatcatcagaacaaactaataaagtatcaactaaggaa
agtggcagcataacgggaaacctgtcccaactcaaaccagatagaaagcaagctgctggt
atttgtgaagaacctgaatccagttcaattaaagctaaccaaaaagaaggctgctcaatg
ccaggaaaaaatggtggatttcagccagccagtgggaacacagttgctatttcatgtgag
gctctgttaagaccaaagctgctgagtgaaaacaaagtggatgatgatgggatttgtgct
ccgtcccaactttctgagacccccgtttcaggtccaggtctgatgaatggtggatttttt
tcagcaagtggtaaacctgtggcaatttcatctgaggctttacagaaagcaaaggctctt
tgtagcgacattagtgtcacaacagctctaccatatccaactgctcaaagtaaaaaggaa
aaaatgaagtgtggtctcacaaatgtaggggtaacaaatgttataaattcagagttatca
catgtaaaatatactgaaggaactttaaaccccatttctcccccaagaagtggtaatagg
aagaaccactcagcggttcaatcttttcctttagcagcagacattggaagtgaccatgaa
gaaaagccatgcatgatagtctgtgatttagacattaaaaacagcatcaagagatctgaa
gttctaacaacaggcccagaatttcagtcattgaacctcgctggctgtacagaaacccaa
caaatgatttttgctcaggaagcttttgattgtacaaaagccttactagatgatgaagtt
cggattggccagagcttgttgatgggttcagaacatttccaaataccagaagactgcaaa
tcaaatggcaaatctaccgaagaagccaaaaggaagaaaactagaagtgctgaagatcta
actgctcagcccccttccaaacgaagattactagaggaattcagtgaaaccaccgatggt
ccaagaggttcagggcttcaccccataaaaagctctccaaatggtttaatggacagggga
gtgttcaagtacaatacctctcttcatccacacatcacaaagcctcacagggatgcaaaa
agttttgtgcaaagcagataccaaaggacaacagatacaaacccaggagatcatacatcc
gcatcctccaagatgcaagcctttgttcctccatttatcaaaagcgcaaagagagctgta
tccaataatccagaagtcggagaccgcaaaagagtacctgtgtttgttccccccttcaaa
aaacaacgaattgtcctacaagtgagctcgcctaaacaacaggggagtgacaccaacaac
gacgtaacacttaccaagaaaaccccaagctctacagatattgtccctttaatgaagtct
tcaaacactaatgtgatgattccaagtgttcctgaaaacgaggagccagttggcgctgct
gaaacatcacatgtggacaacaagctttccagaagccaagacaggacagagaatattatg
ttggcccgggatatgcaggacatgaggattaggaaaaagaagcggcagaccattcgaccg
ctccctgggagcttatttttgacaaaaacctcaggagttttgagaatccctttaaaattg
gcagtaaatggaaataaaccaaccagatgctctgcaaaagagttgtatgagtgcggagtc
cacaagcatgttcctgagatcaccggagcaaacgccgaatcgtttcggttcaacttgctg
cagttcatcaaacaggaaatgataacagatgggggcggtgttcaactcgctgacggaggc
tggttgatccccagcaacgactggacggcgggaaaagaagaattctatagagcattatgt
gatacgcccggtgtggatcccaaactgatcaccgagcagtgggtttacaatcactaccgg
tggattgtgtggaagcaggcctccatggagaaatcctttccagaaaaaatgggcagtctt
tgcctcactccagagcagattctcctgcagctgaagtacagatatgatgtagaggtggac
cacagccgcaggccagctctgaagaagatcatggaaagggacgacacaccagccaaaact
cttattctgtgtgtctgtgagatcgtctccagaggtcacctgctaaacgcacagagccgc
agcgacacaaagacaacacaaagtgctgaaaacaatccatcagccatcatctggttgaca
gatggttggtatgccatcaaagcacagctggatgaacctctgactgcaatgcttcacaaa
ggtcggcttgctgtcggcggcaaattgatgatccacggagcccaactggttggatcacaa
gatgcctgctctcctttagaggcaccagactctctaatgttgaagatatgcgccaacagt
acgaggcgagcgcggtgggacgctaagctgggatttcacaaagatcctcgaccgtttctg
ctccccatctcctgcctattcagtaatggtggactagtaggatgtgttgatgttcttata
ctgagaagttacccaatgcagtggatggagaggaaatcagatggtggtgttgtgtttcgg
tcggatcgggcagaagagaaggaggcaagaagattcagccaccataaacaaaaagtgatg
gagatgctgtttgccaagattcaagctgaatttgaaaaagaggaggaagggagagcgaaa
ccacagcgcagaaggcagacaatcagcaagcaggatgttgcaaacttgcaagaaggggta
gaattatatgaagcagttggagacgaccctgcatacctggaggctcatttaagtaaaaaa
caaatggagactcttcaggcctacaggagttctctgatggagaagaagcaggccgagctg
caggacagatatcgccgagctctggatgcagaagacaatgaaatgagctgtccaaaaaga
gatgtggcacctgtatggagactttgcatcgctgactcaaaggaccagtccagttgtgtt
tataagttaaacctttggcggccttcctctgatcttcagtctctactgaaggaaggttgc
cgattcaaagtctataaccttgccgtctcggatggaaagaaccgcagcaccattgaaacc
gttcagctgaccggaacaaagaaaacacagttccaggaaatgccggcgtccccagaatgg
ctgtcatcacgtttccagcccagagtcgccacagactttgcagatcttcaaaatgaagaa
ttcaagcccctgtgtggagaagttgatcttgtaggatatgtgatcagtgttatagatcaa
cagggtccctctcctgcgttttatttggttgacgggaagcagaattttgtgaaagtgcgc
tgttttaccagcttggctcaagctggccttgaagatgtggtaaaaccaggtgtcctgttg
gcactgagcaacctgcagctcagagggcagtctatgtaccctacccctgtggtgtatgct
ggggatctgactgctttctccacaaaccccaaggagattcatctacaggaatccctccag
caactcaaaagcctggtccagtgtcaggacaacttctgtccatctgctgaggaaaagctt
gcccagttagtcaagtctgatggcatgcagtcggtctgctctccatctttgcaaccacaa
cctgcaggctctgcaacagacagaagacaaagcttaagctcaaacgtgacctttcagaaa
ccaggtaaaagccttggatccttcacacctgtcagcagtaaactccctgcaccaacatct
tcaacagaaaaagaccctaaaagcctgaaaagaaaaagggctttggattatctttctcgc
atcccttctccacctcctatttccccccttggctcagtagtttcaccttgtgtgaaaaga
acattcaatccacctcggaggtctgggccaccaagcactttaaaacccgcacagactgtt
gaaccgaagcgggctgattctctagtggaggatgagtgggtgaacgatgaggaactggct
atgattgatacgcaggaattgcatgttggaaatttattgtag

DBGET integrated database retrieval system