KEGG   Cyprinodon variegatus (sheepshead minnow): 107092357Help
Entry
107092357         CDS       T06110                                 

Gene name
rev3l
Definition
(RefSeq) DNA polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107092357 (rev3l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107092357 (rev3l)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     107092357 (rev3l)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    107092357 (rev3l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4683 DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Motif
Other DBs
NCBI-GeneID: 107092357
NCBI-ProteinID: XP_015242281
Ensembl: ENSCVAG00000023118
LinkDB All DBs
Position
Unknown
AA seq 2877 aa AA seqDB search
MFAVRIVTADYYLSSPIKGLDVCYSEFRDSEVKKVPVVRIFGATPAGQKTCLHLHGVFPY
IYVPYDGCTQQPERYMRQVAFSIDRALNVAMGNPAASTQHVFKVVLVSGMPFYGFHAKEK
HFMKIYLYNPQIVKRVCELLQSGAVMNKSYQPHEGHIPYLLQLFMDYNLYGMNLINMGAV
KFRRSHNKDGAAPEADPSSSSSHPSISPWKIPCSTRLNDSSLAGTFVRWEESALPCSLVL
ENVERQSTCELEVDAVAVDILNRLDIENQIGRNPGLQAIWEDEKQRRRENNQSSQIEAPQ
SQERSSVTLTDSEQTFLKRLKDILRENKFDLTQDLPLDDEESFSAELTLHPDQPTPDELP
CTAANAVQEHRDSQPDSERSSGRVPEEAVVDEEAILSLLESSQTFLPLSQTSNHSPLLES
SQDHALIDLLAGLEDDGFHRSPLRQASKSHSLAGAAAYHCNSDEEEAGPELAKEEAELSM
IMSQRWDSERHGRTDPLRPGVRDAEDGFSDEQQESSDEDMDWSGNHSLFADLSIPQLDGA
ADESSDSSLTDTGSMSQSSLTVTEKLLGQNSPCTGESVHLEPPSPAKILLCKHPEHRPGR
VLDTEEQLENPFQLKSSQDGASGCSAGFRVNKEIPYILPVKHPIPGKISAHSEVSPICMD
KEDIRPLYACNKKSSKPTDKVELEGFPFAAGKVSKHRKQYSSLETVEAKSLSIFQKHSTI
SLCYPDLRTCSAKTELELSTKERKSPILRSITSTPSLMKDGEFRDPREEEMAPESEEGDV
GELKIRYEDYQENKTERTIVAQQEAHYKFFPSVILSNCLNRKKSGNKKPADACCKPEPSP
PCKLKLKLPKKRLGMAGHRSKALMCQSLSSDGPVSTELSSTTPALHDSETEGPISEDQPE
SQAEADKEAEPVVNRELDGEKKPVIDPIEPEAVVSNLTVESSSCEEAKETTEENLSLDPP
SSAKVRHTKPSTLPGSKYKLRAKRKMTPDGDSEDHPVSSCSKKPGKLPGWQETKQNKRRK
REPPVIIKYIIINRFKGQKNMLVKMSKVSAEEQQVVLTPDKMERYNKLAPLKSFWPKVPE
STAVRFPIKEPKAKKAPKRKTRVNNANKNLISGSPKTPATKRGRMRRTKGCPRRPVLPSL
PPPRPSYCELADDTEKDYADVMVELGYLSDRSPSPTESTPPRCWSPSEPSLSCSEKLINP
LSDPCLSSAPQKPATKRARNAKAKRSANSKQTAKGSAKSSEAQEPKVEKSRKRNAATPRQ
RKKAKDGAESPATFPQPRRSRKKKTSDSCRADSQQRVPPPKDSPKEVPPSQQPLGPNHSS
ANRESTPAPSTSFVKPKAEDCETSIMEANQSLLAPVEVKQQGCQTAVVKAESFPEESAAP
QPEDVKRENGFPKNGEVPPLPEVSGLAVLKQLLQKRQQGQALPLQAVGTDRHAAALAQAA
VLLNPSAKPIRTPATAPRKPRAPKSAASKEKRPRTRKARTSCTQPEQPGKQDGSTSDDCL
LFSSAPSLASCNFIEDSLSPELPAAYTFDINTIHQAEFSSPYSGSQFVLTDKNLPVKFLS
DICQEAPPAQTKCVEELPQGKTHRGSDVGGARAASPELFDSSGNREPSADITSLDCERQR
EWDRSLFKPHILSPFQDFHCERKELLFSAFDPVIPLSLSSVSFIDQEGSPTSELQESIDG
LTSTTPSSSPHSISSLSQARGGQLHRGAAGGAYVLKPLMSPPSREEILSTLMDLDMSEAT
FQEPFCSDPSDIPSRPMEVGGRKLTVGTRLVKELEEFGGDLSLEGLLFWKTAFSVMTHPA
ATIATSSQEAETKEEKTELPESSASDKKVVLLPCRNPPSRERVQLWLEARKQYESLQRGR
RETGKERGEAEVEQDSPERTELPAASRSPSVTVQQCGNVSSTRAQRRKKLNLSFLLSPLA
DGARSSAESPGSDESGASPEPEDKDEDEDDASKITSPESPELPPWQESHQLSPERLINRK
PCENSPEPLSPMQQEPGEGRSPSPFLSNDRDGDSSPLPLHSTPFMRKRRRSTEEHDPVCS
TPMSDKDPVSPRLQQRRRSQADPLRRVLLTTQMKNQFAAINVPKKDQSQIEGPSIANSYG
FKVSMQNLQDAKALHEVQYLTLMGMELHARSRRDLEPDPEFDPICALFYCFSSDAPLQGE
DGTQLTGAIMVDREHQSAGRGCRATAPLLVRSGVSGLQVTYASEEKMLFQELITIMRRFD
PDILVGYEVQMRSWGYLLQRAAALGVDLCQQLSRIPGDSKENRFAAERDEYGADTMTEIN
IIGRVTLNLWRVMKSEAGSSTHTNYRVESMMLRVAKPLNYIPVTPSVQQRAQQRAPQCIP
LVMEPESRFYSNSVVVLDFQSLYPSIVIAYNYCFSTCLGHVDSLGTPDEFRFGCTSLRVP
PELLHQLRNDITVSPSGIAFVKSSVRKGVLPSMLEEILNTRIMVKQSMKTYKQDKALMRL
LDARQLGLKLIANVTFGYTAANYSGRMPSVEVGDSIVHKARETLERAIKLVNDTKKWGAR
VVYGDTDSMFVLLKGATKEQAFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYV
GYMYESLDQKEPTFDAKGIETVRRDGCPAVSKILERSIKLLFETRDISQVKQFVQRQCAK
VLDGRASMQDLTFAKEYRGSGSYRPGACVPALELTRRMMAYDRRLEPRVGERVPYVIVYG
MPGVPLIQLVRRPMEVLQDPSLRLNATYYITKQILPPLGRLFQLIGVDVFSWYQELPRVQ
KASCSSGLGGEEPTGRKGTISQYFTTLHCPVCDELTQLGVCSRCRADPQRVAVTLYQDMR
QWESQQEQLLKICRNCSGCAERQVPCVSLDCPVLYKLSRVSRQLSKAPYLRQLLEQF
NT seq 8634 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtgcggatagtcaccgcagactactatctgtccagccccattaaaggcctg
gacgtgtgttactctgaattcagggacagcgaagtgaagaaggtgccggtggtgcggata
tttggagccactccagcaggtcagaagacgtgtctccacctccatggcgtgttcccctac
atctatgtgccgtacgatggctgcacacagcagccagagcgctacatgcggcaggtggcc
ttcagcatcgacagggccctcaacgttgccatgggaaaccccgccgccagcacccagcat
gtcttcaaggtggtgctggtctctggcatgcctttctatggttttcacgccaaagagaag
cactttatgaagatctacttgtacaatcctcagatagtgaaaagagtgtgtgagctttta
cagagtggagcagtgatgaacaagagctaccagcctcacgagggccacatcccctacctc
ctgcagctcttcatggattataacctgtatggcatgaacctgattaacatgggagctgtg
aagttccgcaggagccataacaaagacggagcagctccagaggcggatccatcatcttcc
agctctcatcccagcatcagtccctggaagatcccctgttccaccaggctgaacgacagc
agcctcgcaggtaccttcgtccgctgggaggagagcgctctaccctgctctttagtcctg
gagaacgtggagaggcagagcacctgtgagctggaggtggatgctgtggctgtcgacatc
cttaaccgcctcgacattgaaaatcagattggaaggaaccctggactgcaggctatttgg
gaggatgagaagcagaggaggagggagaacaaccagtcctcccagatagaagctcctcaa
tcacaggagcgtagctccgtcacgttaacggacagcgagcagaccttcctgaagagactg
aaggacatcctgagggagaacaagtttgatttaacccaggatttgccgttggatgatgag
gagagtttctcagcagagctcaccctgcatcctgaccagccgaccccagacgagctgccc
tgcaccgctgctaatgctgtgcaggagcacagggactctcagccagactcggagaggagc
agtgggagagtcccagaggaggcggtcgttgatgaggaggccatcctaagtcttctggag
agcagtcagacttttctcccactctcacagacgtccaaccactccccgctgttagaaagc
agtcaagatcacgccctcatcgatctgctggcaggcctggaggatgacggcttccaccgg
tcccccctcagacaggcctctaagtctcattcgctggctggcgcagcagcctaccactgt
aatagtgatgaagaagaagccgggccggagctggcgaaggaagaggcggagctcagtatg
atcatgtcacagcggtgggacagcgagcgccatgggagaaccgacccgctgaggcctgga
gtcagggatgcagaggacggcttcagcgacgagcagcaggagtcctctgacgaagacatg
gattggagcgggaaccattccctgtttgccgatctgtccatcccgcagctggatggggcg
gcggacgaaagcagcgattcctccttaacggacacaggctccatgtctcagtcctcgctt
acagtcacagagaagctgttgggacaaaacagcccttgcacaggagagagcgtccacctg
gagccgccttcgcccgctaagatcctgctgtgcaagcatcctgagcaccggccaggccgc
gtgttggacactgaagaacaactcgaaaacccctttcagttgaaaagcagccaggacgga
gctagtgggtgttctgcaggtttcagggtcaataaagaaatcccgtacatcttgccagta
aagcacccgattcctggtaaaatatccgcccactccgaggtctctcccatttgcatggac
aaagaggacatccgtcctttgtatgcgtgtaacaagaagagctccaaacccacagataag
gttgagctggaaggcttcccctttgctgctggaaaggtgtcaaaacacaggaagcagtac
agcagcctggagacggtggaggctaaaagtttgtcaattttccagaaacacagcaccatc
tccctctgctacccggacctcagaacctgctctgccaagacggagctggagttgagcact
aaggagagaaaaagcccgatcctgaggagcatcacctcaacgccgtcgctcatgaaggac
ggcgagttcagggatcccagggaggaggaaatggccccagaaagcgaggaaggagatgtc
ggggaactcaaaatccgatacgaagactaccaggaaaataaaaccgagcggactatcgtg
gcccagcaggaagcgcactacaagttcttccccagtgtgatcctctccaactgtctcaac
agaaagaaaagcggaaacaaaaagccggcggacgcctgctgtaaaccagagccatccccg
ccttgcaagttgaagctaaaacttcctaaaaagaggttaggaatggccggccataggagc
aaagcactgatgtgtcagagcctgtcctctgacggcccggttagcacagagctctcctcc
acaacgcctgctttacacgattcagagaccgaggggccaatttcagaggaccaaccagaa
tcacaggccgaggcagataaagaggccgagcccgtcgtaaacagggagttggatggtgag
aagaagcctgtcattgacccgatagaaccagaggcggtcgtctccaacctcaccgtcgag
tcctcttcttgcgaagaagccaaagaaacaaccgaagagaatctgagccttgatccgcct
tcatctgctaaagttaggcacactaaaccgtcaacactgccaggaagtaaatacaagcta
agggcgaaacggaaaatgacccctgatggcgacagcgaggaccacccagtttccagttgt
tccaaaaagccgggcaagcttcccgggtggcaggagaccaagcaaaacaagagacgcaag
agggagcctcctgtcatcatcaagtacatcatcatcaaccggttcaaaggacagaagaac
atgttagtgaagatgtccaaagtgagcgctgaggaacagcaggttgttctgactcctgac
aaaatggagcgttacaataaactggctcctctgaagagtttctggcctaaagtaccagag
tccacagctgtcaggtttcccatcaaagagcccaaagctaaaaaagcacccaaacggaaa
acgagggtcaacaatgccaacaagaacctgatcagcggctcccccaaaacgcccgcgacc
aaacgaggaaggatgagacggactaaaggctgcccaaggcggccggttctgccctcccta
cctccacctcggccgtcttactgcgagcttgcggacgataccgagaaagattacgctgat
gtcatggtagaactgggctatctgtcagaccgatccccgagccccactgaatccacgccg
ccgcgctgctggtccccgagcgagccttccctgagctgctcagagaagctgatcaatccg
ctcagtgacccgtgtcttagttctgctcctcagaagcctgcgaccaaacgagcccgaaac
gccaaagctaagaggtccgccaactctaaacagacagcaaaagggtccgccaagtcctcg
gaggcacaagagcccaaagtggagaaatccagaaaacgaaacgccgctactccaaggcag
aggaagaaagctaaagatggagcggaaagtcctgcaacgtttccgcagcccagaaggtcc
cgcaagaagaaaaccagcgattcatgtagagcagactcccagcagcgggtccctccaccg
aaggattcccctaaagaagttcctccatctcagcagccattaggccccaaccacagcagc
gccaacagggagtccactcctgctccctcgaccagcttcgtcaagccgaaggcggaggac
tgtgagacctccatcatggaggccaaccaaagtctgctggctccggtagaagtgaagcag
cagggctgtcagaccgccgtggtgaaagcagagtccttcccggaggagagcgccgcccct
cagcctgaagatgtcaagagagaaaacggttttcctaaaaacggggaggtccctcctctc
cctgaggtctctggcctggcggtgctgaagcagctcctccagaagaggcagcagggccag
gcgctccctctgcaggcggtcggcacagacagacacgctgccgccctcgctcaagccgca
gtgctgctaaacccctccgccaaacccatcaggacccctgctactgctcctcgtaaaccc
cgcgccccgaaatcggccgcttccaaagagaaaaggcccagaaccaggaaagccaggacc
agctgcactcagccggaacagccagggaagcaggacggcagcacgtctgatgactgcctt
ctcttctcctccgctcccagcctcgccagctgcaacttcatagaggacagcctgtccccc
gagctgcccgccgcctacaccttcgacattaacaccatccaccaggcagagttctctagc
ccctacagcggtagtcagttcgttttgaccgataaaaacctccccgtcaagttcctcagt
gacatctgtcaggaagcgccgcctgctcagacgaagtgcgtggaggagctccctcagggc
aaaacccatcgaggctcggacgtgggcggcgccagggcagccagtccagaactctttgac
agctctgggaacagagagccttcggcggacatcacctccctggattgtgagaggcagagg
gagtgggaccggtctctgttcaaacctcacatcctcagccccttccaagacttccactgc
gagaggaaagagctcctgttctccgccttcgaccccgtcatccctctgtctctgagctcg
gtgtcgttcatcgaccaggagggctccccgaccagcgagctccaggagagcatcgatggg
ctgacgtccaccacgcccagcagctcccctcactctataagctcgctatcacaggctagg
ggaggccagcttcaccggggggccgcaggcggagcctacgtcctcaagccgctcatgtcc
cctcccagtcgggaggagatcctcagcacgctcatggacctggacatgtcagaggctact
ttccaggagcccttctgcagcgacccctctgacatcccaagcaggccaatggaggtcgga
gggcgtaagctgacagttggaaccagactggtgaaggagctggaggagttcggaggagac
ctctctttggagggcctccttttctggaagactgccttctccgtcatgacacaccccgct
gccaccatcgccacctcatcgcaggaagcagagacaaaggaagagaagaccgagctccca
gaatcctcagccagcgacaagaaggtggtcctcctgccctgcagaaacccgccgagccgg
gagcgcgtgcagctgtggctggaagccaggaaacaatacgagagcctgcagagagggagg
agagagacggggaaggagaggggtgaggctgaggtggagcaggacagtccggagagaacg
gagctgccggccgcgtccagaagcccctcggttaccgtccaacagtgcgggaatgtttcc
agcaccagagctcaaagaaggaagaagctcaacctgtctttcctcttgtctcctctggcg
gatggagccagatccagcgcagagagtccaggttctgatgagagcggggcgagcccggag
ccggaggacaaagacgaggatgaagatgatgcttctaaaataacttctccagaatcccca
gagctgcctccatggcaggaatcccatcagctgagccctgaacgcctcatcaacaggaag
ccatgtgaaaactcacctgaaccattgtcccccatgcagcaggagcccggagagggccga
tctccttccccgttccttagcaacgacagggacggagacagcagcccactccccctacac
agcacccccttcatgaggaaaaggaggaggagcacagaggagcatgatccggtgtgcagc
acccccatgagtgacaaagatcctgtttctccaagacttcagcagaggagaagaagccaa
gctgatcctttgagaagagttttactgaccacacagatgaagaaccagtttgctgctata
aacgtgccaaagaaggaccagtctcagattgaagggcccagcatagccaactcgtacggc
ttcaaagtcagcatgcagaacctgcaggacgccaaggctctgcatgaggtccagtacctg
accctgatgggaatggagctccacgcaagaagccgccgtgacctggagcccgacccagag
tttgaccccatatgtgccttattctactgcttcagttctgatgcccccctgcagggagaa
gacggcacccagctgacgggcgccatcatggtggacagagagcatcagagcgcggggcga
ggctgcagagcgacagcgccgctgctggtcaggtcaggcgtctctgggctgcaggtgacc
tatgccagcgaggagaagatgctgtttcaggagctcatcaccatcatgagaaggttcgac
ccagacatcctggtgggctatgaggttcagatgcgttcatggggctacctgcttcagcgt
gccgctgcgctgggagtggacctctgccagcagctgtcccggatcccaggcgactccaag
gaaaaccgcttcgccgccgagagggacgagtacggcgccgacaccatgactgagatcaac
atcatcggacgcgtcaccctcaacctgtggagggtgatgaagagtgaggcaggttcctct
acacacactaactaccgcgtggagtccatgatgctccgcgtggccaagcctctgaactac
atccctgtgacgcccagcgtgcagcagcgagctcagcagagggcgccgcagtgcatccct
ctggtgatggagccagagtcccgcttttacagcaattctgtggtggttctggacttccag
tcgctgtatccctccatcgtcatcgcctacaactactgcttctccacctgcctgggccac
gtggacagcctgggaacgcctgatgagttcaggttcggctgcacgtctctgcgggttcct
cctgagctgctccaccagctccgtaacgacatcacagtctctccaagcggcatcgccttc
gttaagtcgtcggtgcgtaaaggcgtcctgcccagcatgctggaggagatcctcaacacc
aggatcatggtgaagcagtccatgaagacctacaagcaggacaaggccctgatgaggctg
ctggacgcccggcagctcggactcaagctcatcgccaacgtcaccttcggctacaccgcc
gcaaactactctgggcggatgcccagcgtggaggtgggagacagcatcgtccacaaagcc
agagagaccctggagagagccatcaagctggtcaatgacaccaagaagtggggagcacgt
gtcgtatacggagacacagacagcatgtttgtcctgctgaaaggagccaccaaggagcag
gccttcaagatcggacaggagatcgccgaggccgtaaccgccaccaaccccaaacctgtc
aagctcaagtttgagaaggtgtacctaccctgtgtgctgcagacaaagaagcgctacgtt
ggctacatgtacgagagtctggatcaaaaagagccgacgtttgatgccaaagggatagaa
acagtgcgtcgtgatggatgccccgcggtttccaagattctggagcgttccatcaagctg
ctgtttgagacgcgagacatcagccaggtgaagcagttcgtccagcggcaatgcgcgaag
gttctggacggccgggccagcatgcaggacctgaccttcgcaaaggagtaccgaggcagc
gggtcgtaccggcccggagcctgcgtgcctgctctggagctcaccaggcgtatgatggcg
tacgaccgccggctggaaccccgcgtgggagagagggtcccctacgtgatcgtgtacggg
atgcccggcgtgcccctcatccagctggtgcgccgccccatggaggtcctgcaggacccc
agcctgcgcctaaacgccacatactacatcaccaagcagatcctgccgccactcggccgc
ctgttccagctgatcggggtggacgtcttcagctggtaccaggagctccccagggtccag
aaagcttcctgctcctctgggctgggcggggaggagcccactgggaggaagggaaccatt
tcccagtacttcaccacgcttcactgccccgtctgtgacgagctgacccagctgggggtg
tgctcgcgctgccgggccgaccctcagagggtggcggtgaccctgtaccaggacatgagg
caatgggagagtcagcaggagcagctgctcaagatctgcaggaactgcagcggctgcgct
gagcggcaggtcccctgcgtgtccctggactgtcccgtcctctacaagctgtcccgggtc
agcagacagctctccaaggccccctacctcagacagctgctggagcagttctga

DBGET integrated database retrieval system