KEGG   Cyprinodon variegatus (sheepshead minnow): 107093411
Entry
107093411         CDS       T06110                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04080  Neuroactive ligand-receptor interaction
cvg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107093411 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107093411 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cvg04030]
    107093411 (lpar2)
G protein-coupled receptors [BR:cvg04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107093411 (lpar2)
SSDB
Motif
Pfam: 7tm_1 TMEM192
Other DBs
NCBI-GeneID: 107093411
NCBI-ProteinID: XP_015243939
Ensembl: ENSCVAG00000023363
LinkDB
Position
Unknown
AA seq 359 aa
MENNMSSQCNSSHNVTFFYKLVEKEIRENWTTRDSLLLGLGLPFSLIVVLANLLVMVAIV
LNHRFHLPIYYLLGNMAAADLFAGLAYANLILNTGPWTRRLSKTQWYIRSALVDISLTSS
VANLLAVAFERHQTIITMQLHSTMSKRRVLLLIVSIWVAGIIMGLVPSLFWNCECDHNDC
STIAPLYSRRFLIFWAGLNLLTFFIMVIMYSRIFFYVKCQNRNVSPHTMEERQQTVINLM
KTISMVLGAFVICWTPGLITLLVDGLLGKNSNAKKYEKYCLVIAECNSLVNPIIYSLRDV
EMRKTFKWILSCLCRKGDCRQRESLPTDTGSQLTEKTLTTLHTYMLEDQVLLEPEDTKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggagaacaacatgtcatctcaatgcaattccagccataatgtgaccttcttctacaaa
ctagtagaaaaggagatcagagaaaactggactacacgggactccttattactcggacta
ggtttgccattttctttgatagtggtgctggccaacctgttggtgatggtggccatcgtc
ttaaaccaccgcttccacctccccatatattacttgctgggcaacatggcagcagcggac
ctgtttgcaggtttggcctacgctaacctcattctcaacactggcccctggactcggagg
ctttctaagacccagtggtacatccgttccgctttggttgacatcagcttgacatcctct
gtagccaaccttctggctgtagcctttgaacgccaccagaccatcatcaccatgcagctg
cacagcaccatgtctaagagacgtgtgctgctgctcatcgtctccatctgggttgctgga
atcatcatgggtctggtgccatcgctgttctggaactgtgaatgcgatcacaacgactgc
tctaccatcgccccactctacagcagacgcttcttgattttctgggcaggtctcaaccta
ctgacatttttcattatggtgatcatgtactcccgcatattcttctatgtgaagtgtcag
aataggaatgtgtcccctcacaccatggaggaacgacagcagactgtcatcaacctgatg
aaaaccatttctatggttctgggtgcttttgtgatctgctggacacctggcctcattact
ctcctcgtggatgggctgttgggtaaaaatagcaacgctaagaagtatgagaagtactgt
ttggtgatagcagagtgcaattctttggtcaacccaatcatttattccttgcgggacgtt
gagatgagaaaaacttttaaatggatcctttcctgcttgtgtcggaaaggagactgtcgg
cagagggagtctttgccaacagatactggatctcaattgacagagaaaactcttacaact
cttcatacgtacatgttagaagatcaggtgttgttggaaccagaggacacaaagagataa

DBGET integrated database retrieval system