KEGG   Cyprinodon variegatus (sheepshead minnow): 107093789
Entry
107093789         CDS       T06110                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04210  Apoptosis
cvg04620  Toll-like receptor signaling pathway
cvg04621  NOD-like receptor signaling pathway
cvg04622  RIG-I-like receptor signaling pathway
cvg04623  Cytosolic DNA-sensing pathway
cvg04625  C-type lectin receptor signaling pathway
cvg04920  Adipocytokine signaling pathway
cvg05132  Salmonella infection
cvg05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107093789
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107093789
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107093789
   04621 NOD-like receptor signaling pathway
    107093789
   04622 RIG-I-like receptor signaling pathway
    107093789
   04623 Cytosolic DNA-sensing pathway
    107093789
   04625 C-type lectin receptor signaling pathway
    107093789
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107093789
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107093789
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107093789
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107093789
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107093789
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 NBD94
Other DBs
NCBI-GeneID: 107093789
NCBI-ProteinID: XP_015244550
Ensembl: ENSCVAG00000012843
UniProt: A0A3Q2CXS3
LinkDB
Position
Unknown
AA seq 580 aa
MVQPQPDGPMQWDMSGEDSGGTLRVPPELAGNEVVTRLLGDNQQLRDALRRSNQALRQRC
EEMEGWQRRARQEREFLSCRFQEARALVERLAQENHSLQSMVSGPGSSSNHSYALSQTEV
SPGLSARNGPLDEAKTLDQWERKRVEETEQQTQTTPLRSLPAEGSNECLQLLKKHKEKTE
EEMRELRKKTEELKRERDEGKEVIERQHRCIDHLRSKLFQTQTSGNEEAVQLRSEAQHTS
DCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKECAQLAKDCEAL
KAQATSLLGELNERQILLQKSDDDRKMLEEKLVSKVKALQVAEREQEQQKKQHHVAMDKL
MLQVESLENALKTERHVVTEEKKKLSQLQHAYTCLFRDYDSKLKSEGGDLSSKLEEAEQA
LAIKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQL
TQALAEIDRLKQEATSRARLEQMKMKYMDEFPARPAHLPSQQVFPGFSNTVPPNRNHVLV
SVNDPGAPGAADLPDLCCPKCNYLAPDMDTLQIHVMDCIQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggtgcagccgcagcctgatggccccatgcagtgggacatgtctggggaggacagcgga
gggaccctaagggtcccgccggagctcgctggaaacgaagtggtgaccagactactgggc
gacaaccagcagctgcgagatgctctacggaggagcaaccaagccctgcgtcagcgctgc
gaggagatggaaggatggcagcgacgagcgcggcaggagcgggaatttctcagctgccga
tttcaggaggccagggcgctggtggagaggctggctcaggagaaccattctttgcagagc
atggtgagcgggccaggctcgtcctccaaccacagctacgccttgagccagacggaagtc
tctccaggactttccgccaggaacggacctctggacgaagccaagactctagatcagtgg
gagaggaagagagttgaagaaacggagcagcagacacagaccactccacttcgcagcctg
cctgcagagggatccaacgagtgcctgcagctgctgaagaaacacaaagaaaaaaccgaa
gaagagatgagagagctgagaaagaaaactgaagagctgaagagggaacgggatgaaggc
aaagaagttatagagcgacagcatcgttgcatcgaccacctgcggagtaaactcttccag
acacagacaagcggcaacgaggaagctgttcagctgcgctccgaggcacagcacacctca
gactgctctagtctggctaaactcacagagcaacttcaggccacacagggcaggtatcgg
gagctggaggagaagctggattacctgcagaagagctcagctcagcgtgacagaacagaa
gctctgctcaagcagaaggacaaggaatgtgctcagctggccaaggactgcgaggctctg
aaggcgcaggccacgtccctgctaggtgaactgaacgagagacagatcctcctacagaaa
agcgacgacgaccgcaaaatgctggaggagaaactggtcagcaaggtgaaggccctgcag
gtggcagagcgagagcaggagcagcagaagaagcagcatcacgtggccatggacaaactg
atgctgcaggtggagagcctggagaacgccctgaagacggagagacacgtggtcacagag
gagaagaagaaactgtcccagctgcagcacgcctacacctgtctgttcagagactatgac
tccaaactgaagagtgaaggaggagatcttagcagtaaactggaggaggcggagcaggcg
ctggccatcaagcaggacctgattgataaactgaaggaggaggtggagcagcagaaaggc
tcgctggagaccgtccctgtcctcaccgcacaggctgagatctacaaggccgacttcctg
gcagagcgagaagccagagagaagctgaaccagaagaaggaagagctgcaggaacagctc
actcaggctctggctgagatcgacaggctaaagcaggaggccacctcccgtgcccgtttg
gagcagatgaagatgaaatatatggacgagtttcctgcacggcccgctcaccttccctct
cagcaagtgtttcctggcttttcaaacacggtgccgccgaaccggaaccacgttctggtt
tctgtcaatgatccaggagcaccaggagctgcagatctgcccgatttatgttgtcctaag
tgcaactacttggctccagacatggacacgttgcagatacatgtcatggactgtatacag
taa

DBGET integrated database retrieval system