KEGG   Cyprinodon variegatus (sheepshead minnow): 107093970Help
Entry
107093970         CDS       T06110                                 

Gene name
ercc4
Definition
(RefSeq) DNA repair endonuclease XPF
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03420  Nucleotide excision repair
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    107093970 (ercc4)
   03460 Fanconi anemia pathway
    107093970 (ercc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cvg03032]
    107093970 (ercc4)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107093970 (ercc4)
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     107093970 (ercc4)
DNA replication proteins [BR:cvg03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107093970 (ercc4)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     107093970 (ercc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC4 HHH_5
Motif
Other DBs
NCBI-GeneID: 107093970
NCBI-ProteinID: XP_015244832
Ensembl: ENSCVAG00000006171
LinkDB All DBs
Position
Unknown
AA seq 900 aa AA seqDB search
MAAPLLEFETEMFLSLFESDGLLVAAEGLGIDRILLQFMRVYSEEGSLVLLLNTTTPEQE
YFTEQLRIEGVSHLPRTVTSDVQSTERYNVYTEGGVLFVTSRILVVDFLTDRIPAHLISG
ILVYRAHKIIESCQEAFILRLFRQKNKTGFIKAFTDKATAFSSGFCQVERVMRNLFVKKL
YLWPRFQASVNTALERHKPEVVELHVSLTPAMRAIQSSIMDIMSACLKELKRYNPTLEAE
DLSLENTLGNAFEKTVRHYLDPLWHQLGAKTKALVQDLKVLRVLLLYLTQYDCVTFLNLL
ESLRSSQKIFGSNSGWLFLDSSTSMFVNARSRVYRIPETKKKPKLVGEAEKTKPSSASEV
KRELVLEKSPKWEVLTEVMKEIEKENKNSQNEPGRVLICASDDRTCAQLQQFLKHGSDWL
LNRLYARTIGKRDPGAAAAFELDAQKKKKDWQKRGAKGKEPARKKNSKPTKGKSRPSLTL
TQMMGKEESDEAAPMGSSEDEDDLMEEDEGEEEQLKLNLSSDAYYGILKEPLTVIHPLKG
CTDPHSLTRVLHEVEPSFVVLYDAELSFVRQLEIYKANRPGKHLRVYFLIYGGSTEEQKY
LTALSKEKKAFEHLIREKATMVIPEEREGRGDTNLDLARNLEPANATTNTRKAGGQEQPK
EPSRVIVDMREFRSELPSLLHRRGLDIEPVTLEVGDYILSPDTCVERKSVSDLIGSLQSG
RLYTQCLSMTRYYRKPVLLIEFDPAKPFSLMARSDFRSEISSNDISSKLTLLTLHFPRLR
ILWCPSPHATAELFLELKQGRPEPDASAAQAVTAESDVVGESADFYNPGPYDFLMKMPGV
NAKNYRALIKAADSLADLAKLSQEKLAEALGNASNAKMLHEFLHNVADVPAPIQKAKQTS
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgctgctggagttcgagaccgagatgtttctgagtctttttgagtccgac
gggctgctggttgcggcggagggtctggggatagaccgcatcctgctgcagttcatgcgg
gtttactccgaggagggcagcctggtccttctgctcaacactaccacacccgaacaggaa
tatttcacagagcagttacgaatagagggtgtgagccatctgcccaggacggtgaccagc
gatgtccagagcactgagcgttacaacgtttacaccgaaggaggggttctgtttgtcacc
agcagaatcctagtagtcgacttcctcaccgatcgcatcccggctcaccttatatcaggc
atcctggtgtaccgtgctcataagatcatcgaatcatgtcaggaggcgttcattcttcgc
ttgttcagacagaagaacaaaactggcttcattaaggccttcactgacaaggctacagcc
ttctcctccggcttctgccaggtggagcgcgtcatgagaaacctgtttgtcaagaagcta
tacttgtggccaagatttcaggcgtctgtgaacactgcgctggagaggcacaagccagag
gtggtggagctgcatgtgtctctaacgccagctatgagagccatccagagctccatcatg
gacataatgagtgcctgtctgaaggagctgaaacgctacaatcctaccctggaagctgag
gacctgtcactggagaataccttgggaaatgcatttgaaaagacagtccgtcactaccta
gatcccctgtggcatcaattaggagcaaaaacaaaagcgctggtccaggatctcaaagtt
ctcagggttctccttctctaccttacccagtacgactgcgtcacctttcttaatctgctg
gagtctctgcgctccagccagaagatctttggttccaactcaggctggctgttcctggac
tccagtacctccatgtttgtaaatgcaaggagcagagtgtatcgtatccctgagaccaaa
aagaaacccaaactagttggagaggcggagaaaacgaaaccctcctctgcctcagaggtg
aagcgggagctggtgctggagaagagtccaaaatgggaggttctgactgaggttatgaag
gagattgagaaggaaaacaagaactctcagaatgaaccaggtcgtgtgctgatttgtgcc
agtgacgaccgcacctgcgcacagctgcagcaatttctcaaacacggctctgattggctg
cttaaccggctctacgcccgcaccatcgggaaacgggaccccggtgcagcggctgcgttt
gagctggacgcacagaagaagaagaaggactggcagaaaagaggagccaagggaaaagaa
cctgctcggaaaaaaaactctaaacccacaaaaggcaaaagcagaccttcgttgaccctg
acccaaatgatggggaaagaggagtcagatgaagcagcaccgatgggcagcagtgaggat
gaagatgatctaatggaggaggatgaaggcgaggaagagcagctgaagttaaatctgtcc
tccgatgcctactatggcatccttaaagagccgctgaccgtcatccaccccctgaaaggc
tgcacagacccacacagcctgacccgcgtgctgcatgaggtggaacccagcttcgtggtg
ctgtatgatgcagagctgagttttgttcgccagctggagatctataaagctaaccggcct
ggaaagcatctcagagtgtacttcctgatctacggaggctcaacagaggagcagaagtat
ctgacagctctgtccaaggaaaagaaagcttttgagcatctgatcagggaaaaagctacc
atggtcatcccagaggagagagaagggcgaggggacaccaacttagacttagccagaaat
ttagagcccgccaatgctacaactaacacccgcaaagcagggggccaggagcagcccaaa
gagccttccagggtcattgtggacatgcgggaattccgcagcgagctgccgtccctgctg
caccgccgcggcctggacatcgagcccgtcaccctcgaagtgggcgactacattctgtct
cccgatacctgcgtggagcgcaagagtgtcagcgacctgattggctcactgcagagcgga
cgcctctacacccagtgcctctccatgacccgctattacagaaaaccagtactgctcatc
gagtttgacccagccaagccattttctttgatggctcgctcggattttcgaagtgaaatc
tcgtcgaacgacatttcctccaaattgacgttgcttacgctgcacttcccccgcctcaga
atactgtggtgcccctccccgcacgccacagccgagctcttcctggagctgaagcaaggc
cgtcctgagcccgacgcttctgcagcccaggccgtcacagccgagtcagacgtggtcggg
gaatcagctgacttctacaaccccgggccttatgacttcctgatgaaaatgccaggagtg
aatgccaaaaactacagagcactgataaaagctgcagacagcctggcagacttggctaag
ctgagccaggaaaagcttgcagaagctttggggaatgctagcaatgctaaaatgctccat
gaatttctgcataatgtggcggatgttcctgctcccattcagaaggccaaacaaacatca
tga

DBGET integrated database retrieval system