KEGG   Cyprinodon variegatus (sheepshead minnow): 107094324
Entry
107094324         CDS       T06110                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107094324 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107094324 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cvg03310]
    107094324 (nr3c1)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107094324 (nr3c1)
Nuclear receptors [BR:cvg03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107094324 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 107094324
NCBI-ProteinID: XP_015245356
Ensembl: ENSCVAG00000014759
UniProt: A0A3Q2D1Z0
LinkDB
Position
Unknown
AA seq 773 aa
MDQGGPQHNGNRNDNLTFVGLGPQVVRDTLDTPDLRLQSAMHLPGPGSMNQSTVAPNGRG
GTKDEGEHSGLFESDKEGKMSRIHKQEQDLFSYGDNLPLLNQSISDFDQMPAAVINTSEN
SVLGNLPLPDLFSQQIKQEGTFSLDKELGTFGGQTGAAAYNLDDRSAPVLDDADIWQDLD
LPNSLPEISAFELDSEVAHLDTILQESSGGGGPEKSLLGNGANCIGLNGAEQQQQQSPHP
LVQHQLQQQQQPPAMLSSVIIKEEKDPDFIRIHTPGVVKQEKQDGAGYCQSQCLQSSMSP
LHGVGNMLSPMDVGAGTGYHYRANPGTVGIQDQKPFGTYQNLQGVGESWVGGKRYGDSSG
IQGTSDRLSSPGALGNFSVGFPSPSARTGENNSTSATGQSKPGGQAHKICLVCSDEASGC
HYGVVTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCL
QAGMNLEARKNKKNKIRVQQLQQRSPEPTGNMSVAIIPRSMPQLVPTMLSVLKAIEPEII
FSGYDSTLPDTSSRLLSTLNRLGGQQVISAVKWAKSLPGFRELHLDDQMTLLQCSWLFLM
SFGLGWRSYEQCNGRMLCFAPDLVINEERMKLPLMGDQCEQMLKICNEFVRLQVSYEEYL
CMKVLLLLGTVPKEGLKCQAVFDQIRMTYIKELGKAIVKREENTSQNWQRFYQLTKLLDS
MQEMVEGLLQICFYTFVNKTLSVEFPEMLTEIITNQIPKFKDGSVKPLLFHQK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggatcagggaggaccacagcacaatggtaatcggaacgacaaccttacatttgtagga
cttggaccgcaagtagttagagacacattggacacacccgatttacggcttcaatctgca
atgcatctacccggtccagggtctatgaatcagagcacagtagcaccgaatggacgaggg
ggaaccaaagacgagggggagcactcgggactctttgagtcagataaggagggtaaaatg
agcaggatacataagcaagaacaggatctattcagctatggggacaatttgcctttgctg
aaccagagtatttctgactttgatcagatgcctgccgctgtcattaacacatcagaaaac
tctgttttgggcaacctacctttgccagacctgttctcgcagcaaattaagcaggagggg
accttctctctggataaggagttaggaacttttggtggacagacaggggctgctgcttac
aatttggatgacagaagcgctccagtactggatgatgcagatatctggcaagatctggac
cttccgaactctctgccagaaatcagtgcttttgaattggattcagaagtggcacatttg
gatactatcctccaggagagtagcggtggtggcggtcctgaaaagtcccttttgggtaac
ggggcaaactgtatcggtttgaatggcgctgagcagcagcagcagcagtctccacacccc
ctggtacaacatcagcttcagcagcagcaacaacctccggcgatgctttccagtgtcatc
ataaaggaagagaaggatcccgatttcatccgcatccatacccctggtgtggttaagcag
gagaagcaggacggtgccggttactgccagtcccagtgtctgcagagtagcatgagccct
ctgcatggagtgggaaacatgttgtctcccatggatgttggagcaggaactggataccac
tacagagccaatcctggtacagtaggcatacaagaccagaagccttttggcacgtaccaa
aacctgcaaggagtcggagagagctgggtaggtgggaagaggtatggagactcctctgga
attcaaggcactagtgatcgcctctcctctcctggagctttggggaatttttccgtcgga
tttccaagcccatcagccagaactggagaaaacaacagcacttcagcgaccggccagtcc
aagcctggcgggcaagcccataagatatgcctggtgtgctcagacgaggcatctggatgc
cattacggggtggttacctgtggcagctgcaaggtcttcttcaagagggctgtcgaagga
tggagagcacggcaaaacacagatggtcagcacaactacctgtgcgctggaagaaacgac
tgcatcattgataagattcgcaggaagaactgcccggcgtgccgcttcaggaaatgtctc
caggcaggaatgaatctggaagcgaggaaaaacaagaagaataagataagagtgcagcag
ctgcagcagcgatccccagaaccaaccggcaacatgtctgtggccatcatacccagaagc
atgccccagctggttcccaccatgctctctgtcctgaaggccatcgagcctgagataatt
ttctcaggctacgacagcacgctaccagacacctcgtcccgtctcctgagcaccctcaac
agactgggaggccagcaggtcatctccgccgtcaaatgggccaagtcgctgccaggcttc
cgtgaactgcaccttgatgaccagatgactttgctgcagtgctcctggctcttcctgatg
tcctttggtcttggttggagatcctatgagcagtgtaacggcaggatgctctgttttgcc
ccagatctcgtcataaatgaggagcgcatgaagctgcctttaatgggcgaccagtgcgag
cagatgctgaagatttgcaatgagtttgtcagactgcaggtctcctacgaagagtacctc
tgcatgaaggtcctgttactcctcggtacagtacccaaagaaggcctgaagtgccaggcg
gtttttgatcagatcaggatgacttacatcaaggagctgggaaaagccatcgtgaaacga
gaggagaacacaagtcagaactggcagcgattctaccagctaactaagctactggactcc
atgcaggagatggtggagggtctcctgcagatttgcttctacaccttcgtgaataagacc
ctcagtgtggaattccccgagatgctgacggagatcatcaccaaccagataccaaaattc
aaagacgggagcgtcaaacctctgctgtttcatcagaaatga

DBGET integrated database retrieval system