KEGG   Cyprinodon variegatus (sheepshead minnow): 107094791Help
Entry
107094791         CDS       T06110                                 

Gene name
rad51
Definition
(RefSeq) DNA repair protein RAD51 homolog 1
  KO
K04482  DNA repair protein RAD51
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107094791 (rad51)
   03460 Fanconi anemia pathway
    107094791 (rad51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cvg04131]
    107094791 (rad51)
   04121 Ubiquitin system [BR:cvg04121]
    107094791 (rad51)
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107094791 (rad51)
Membrane trafficking [BR:cvg04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    107094791 (rad51)
Ubiquitin system [BR:cvg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    107094791 (rad51)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     107094791 (rad51)
    RecA family proteins
     107094791 (rad51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     107094791 (rad51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HHH ssDNA_TraI_N PAXNEB
Motif
Other DBs
NCBI-GeneID: 107094791
NCBI-ProteinID: XP_015246118
Ensembl: ENSCVAG00000017477
UniProt: A0A3Q2EAZ5
LinkDB All DBs
Position
Unknown
AA seq 339 aa AA seqDB search
MAMRSEARVEAEVVEEEENFGPQPLSRLEQCGISTSDIKKLEDAGFHTIEAVAYAPKKEL
LNIKGISEAKADKVLAEAAKLVPMGFTTATEFHQRRAEIIQISTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGL
VGSDVLDNVAYARAFNTDHQTQLLYQASAMMAESRYALLIVDSATALYRTDYSGRGELSA
RQGHLGRFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFSADPKKPIGGNILAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaggagtgaagccagagtggaggcggaggtggtagaggaggaggagaacttc
ggcccacagcctctctccagactggagcagtgcgggataagtaccagtgacatcaagaag
ctggaggatgcagggttccacaccatcgaggccgtggcctacgcccctaagaaggagctg
ctcaacattaaaggcatcagtgaggccaaggcagacaaagtgttggcagaagctgccaaa
ctggtgccgatgggcttcaccaccgccacagagtttcaccagagaagagcagaaattatc
cagatctccaccggctccaaggagctggacaagttactgcagggcgggatcgagacgggc
tccatcacagaaatgtttggggagtttcggacggggaagacgcagctgtgccacacgctc
gccgtcacctgtcagctgcctatcgaccagggagggggagaaggtaaagccatgtacatc
gacacagagggaaccttcagacctgagcggctgcttgctgtagctgagaggtatgggctg
gtaggcagcgacgtcttggacaacgtggcgtatgctcgtgctttcaatacagaccatcag
acccagctgctttaccaagcctctgccatgatggccgagtccaggtatgccctgctcata
gtggacagcgccacggctctgtacaggacagactactccggcagaggggagctgtcagcc
aggcagggacacttgggccgcttcctacgcatgctgctccggttggcggacgagtttggc
gttgccgtggtaataaccaaccaagtggtggcacaggtcgacggggcagccatgttttct
gcagatcccaagaaaccaattggtggcaacattctggcccacgcttccaccaccaggctg
tacctgaggaagggccgaggagagaccagaatctgtaaaatctacgactccccctgtctg
ccggaggctgaagccatgtttgccatcaacgctgatggcgtaggagacgccaaggactaa

DBGET integrated database retrieval system