KEGG   Cyprinodon variegatus (sheepshead minnow): 107095004Help
Entry
107095004         CDS       T06110                                 

Gene name
map3k9
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9 isoform X1
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107095004 (map3k9)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107095004 (map3k9)
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: TKL group
  MLK family
   107095004 (map3k9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_9 SH3_1 SH3_2 Pkinase_fungal DUF3450
Motif
Other DBs
NCBI-GeneID: 107095004
NCBI-ProteinID: XP_015246443
Ensembl: ENSCVAG00000000579
UniProt: A0A3Q2EKI8
LinkDB All DBs
Position
Unknown
AA seq 1037 aa AA seqDB search
MDVFKPALENSLSPRASLSEEAESDVFRWSSTAESEPAQDEERAAPPPGVWTAVFDYEAT
ADDELSLRRGDLVEVLSKDSLVSGDEGWWTGMIADRVGIFPSNYVSKRNRTEEEAGLRDS
SEHPVPPLHLLEIDFSELTLEEIIGVGGFGKVYRAVWRGSEVAVKAARRDPDEDAAQTLE
SVRQEAKLFAMLNHPNIMGLLGVCLQEPNLCLIMEYARGGPLNRALAGKRIPPCTLVNWA
VQIAQGMHYLHDQAIVPIIHRDLKSSNILILERVDMEDLSNKTLKITDFGLAREWHRTTK
MSAAGTYAWMAPEVIRSSTFSKGSDVWSYGVLLWELLTGEVPFRSIDALAVAYGVAMNKL
ALPIPSTCPEPFARIMENCWSPDPHSRPLFTTILDQLTAIEESGFFEMPAESFHSLQNDW
KLEIQEMFDQLRTKEKELRSWEEELTQAALQQKCQEEALRKREQELAEREIHIVERELNI
IIHQLYQEKPHVESRQGKFRRNRLKLKDGNRISLPSDFQHKITVLASPSHDHRRNLLSSG
SSPPTSPLMLPRLRAIQLTPGKDRTEIERKGSRKKGRSRGNGIYREHSADACVKPPHEGS
RQRSCSAPNLRRSPRHSPAVPGVPSLLETENEDCCFTTEPGAAPGQSYLCIPFQKDTHGA
SSIETEGDEYCLRSQAPSTPPCRKSPVGGRRSELVLLGCGALLAAVGLGCNLLTFAQPEE
SIKSRWEGFFHRTAGQRRSTSSPTRRLFQRESPLKTLAPSLPERGLPSSYTLLSLSSISD
SNSTHSLLRSDSDELLICRPSSGSSRPPVPPPVSQRKTVQTPVNSLVNIHVESFKRNPRQ
SLTPTHVPCIPPSSRGLRRTPSDGAIKKNGPPSSLETLPEKKALENTAGGFRGLKEENQE
VPRLPDPNVVFPPTPRRRCAPERPKTLDFVARPRPSPRPRCDVFWGDSRLRGNGHTLGSG
ESPAYTSSTETPPTVEFGRDSTDLPTPMEAPTPFTPSRNANLLDKWDEGQSRDGTVPLCR
PDSSLPKDSPYNPEFWS
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcttcaaaccagctttggagaacagtttgagtcccagggcgtcattatctgaa
gaagcagagtcggatgtctttcgctggtccagcacagcggaaagcgagccggcgcaggat
gaggagcgcgccgcgcctccgccaggcgtctggacagccgtgttcgactatgaggccact
gcggacgatgagctcagcctgcgcaggggagacctggtggaggtcctgtccaaggactcc
ttggtgtcgggagacgagggctggtggaccggcatgatagcagaccgggttggcattttt
ccttccaattatgtcagcaaaaggaacaggacagaggaagaggcaggcctgcgggacagc
tcggagcacccagtgcctcctctgcacctcttggagatcgatttctcggagctcaccctt
gaggagatcatcggagttggtggttttggaaaagtctaccgtgcggtgtggcggggttct
gaggtggccgtgaaggcagcccgacgggaccccgatgaggatgcggcgcagactctggag
agcgtgcgacaggaagcaaagctctttgccatgctcaatcatccaaacatcatgggcctt
ctgggggtatgcctgcaggagcccaacctgtgcctgatcatggagtatgctagaggaggg
cctctgaaccgagctcttgctgggaaacgcatccccccttgtacgttggtaaactgggct
gtgcagattgcacaaggaatgcattacctccatgaccaggctatcgtccccattatacac
agggacctcaagtccagcaacatcctgatccttgagagggtggatatggaggacctcagc
aacaagactctgaagataaccgactttgggttggctcgggagtggcaccgcaccaccaag
atgagcgcggctgggacctacgcctggatggctcctgaggtcatccgctcatccacgttc
tccaagggtagcgacgtgtggagttatggcgtgctgttatgggagctgctgaccggagag
gttccttttcgaagtattgatgctcttgctgtagcctatggagtggcaatgaacaaacta
gctttgcccattccctccacttgccctgagccttttgcacgtataatggagaactgctgg
agtccagatcctcactcgcggccactgttcacaactattctggaccagctcactgctatt
gaagaatctggcttttttgaaatgcctgcagagtccttccattccctgcagaatgactgg
aaattggagatacaggaaatgttcgatcagcttcggaccaaggagaaggagctccgatcg
tgggaggaagagctgactcaagccgccctgcagcagaagtgccaagaggaggcattaagg
aaacgtgagcaggagctcgcggaaagggagattcacattgtcgagcgggagctaaacatc
atcatccatcagctctaccaggagaagccacatgtggagagcaggcagggcaaattccgc
cgcaaccgccttaaacttaaagatgggaacaggatcagcctaccctcagattttcagcac
aaaatcacagtgttggcatctccatcccatgatcatcggaggaatctcctcagcagtggt
tccagcccgccaaccagcccactcatgctgcctcgccttcgagccatccagcttactcca
ggaaaggaccgcacagagatcgagagaaaggggtcaaggaagaagggtcgttcccgtggg
aatggaatatacagggagcacagtgcagatgcatgtgtgaaacctccccatgagggcagc
aggcagcggtcctgcagtgctccgaacctccgcagatccccaaggcacagtccagcagtg
cctggagtaccaagcctactggagacagaaaatgaagactgctgcttcactacggagccg
ggtgcagctcctggtcagtcctacctctgcattcccttccaaaaagacacccacggagcg
tcttccatcgaaactgagggggatgagtactgcctccgcagccaggcccccagcaccccg
ccatgcagaaagagtccagtaggaggtcggcgttctgagctggtcctgcttggatgtgga
gctctgttggcagctgttggactgggatgcaacctgctaacttttgcccagcctgaggag
agcatcaaatccagatgggagggtttcttccacagaacagctggccaaaggcgtagcact
agctctccgactcgcagactgttccagagggaaagtcctttgaagactttggccccctcc
ttacctgaacgaggtttaccatcctcatatacgctcctgtccttatcgtctatttctgac
tctaactccacccattcattgctgcgctctgacagcgacgaactgttgatctgccgtcct
tcgtcgggatcatcccggcctcctgtgcctcctccggtctcacagcgcaagacggtccag
actccagtgaattcactggtcaacattcacgtggagagcttcaagcggaacccccgccag
tcgctaacacccacacatgtcccctgtatcccaccttcctctcggggcctccgtagaacc
ccatcagatggagccatcaagaagaacggtcctcccagctcactggagactttgccagag
aagaaagctttagagaacacagcaggtggcttcaggggtttaaaagaagaaaatcaagag
gttccgcggcttcctgaccccaacgtggtattcccccccacccctcgccgtcgctgtgct
ccagaacgccctaaaaccttggactttgtggcccggcctcgcccttcaccacggccacgg
tgcgatgtgttctggggagactctcggcttaggggcaatggacacaccctgggcagtggc
gagtcccccgcttacacctccagtacagagacaccgcccactgtagagtttggtagagac
tccacagatctgccaactccaatggaggctccaactcccttcactcccagcaggaatgca
aacctgttggataagtgggatgagggtcagagtcgggatggaacagtccccctttgcaga
ccagacagcagccttcccaaagactcaccttataatccagagttctggtcctga

DBGET integrated database retrieval system