KEGG   Cyprinodon variegatus (sheepshead minnow): 107095167Help
Entry
107095167         CDS       T06110                                 

Gene name
fance
Definition
(RefSeq) Fanconi anemia group E protein
  KO
K10892  fanconi anemia group E protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107095167 (fance)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107095167 (fance)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107095167 (fance)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_FANCE
Motif
Other DBs
NCBI-GeneID: 107095167
NCBI-ProteinID: XP_015246642
Ensembl: ENSCVAG00000005690
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MGDGKQRVCSQRSCQSGSCLNSCMPMDRFDGQSRLLLRALMSGFSGAKTALSVFHRQQRA
NQENSLVSFIQTLCRDEVASPEDGALTLTVKPLVCLLPPLFKQNLLTFLYLLHPAIPVPA
VLLLLKCLGEDSTPTPWVTAMVRQLERKLEVNHTDPLYSEQCSQKLKTLSERLGGFCETG
GWADCFISQTEESESHARPDLSQPGTQRKRRASLDHVEADSKEMVQESKRMKMDEDVEEL
VEVEDEKVRLDTGGGSETPANRIHDDLPEHIRGSVLLMQELLESQAEWDQSSADVFQVLN
ECNPNQVEMLCKMLNFPILPEDTLPKLCNGILCLSPDLSYSAAASLIRSVLLEKVSSLSE
PPSRCLVTAVTSLCSRYPRPMCLAVIEPVLQDRNIGPPQTELLNRLIENCLDVHYRLLVL
QMTFRVPWSEAVLSVHSLLDHKLVLSEEVFTQLTEQLISQGSQFTKSVKFAKMMLTVLTK
YSSHVTAAQKHSLAGCLSLNETFLKKSLQAALKRIPDT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggaaagcagcgggtctgcagtcagaggtcgtgtcagtctggttcttgtttg
aacagctgtatgccaatggaccggtttgacggacagtccaggctgctgctcagagcacta
atgtcaggcttttccggggccaaaacggcgctgagtgtgttccatcggcagcaacgggct
aaccaggagaactcactggttagcttcatacagacactatgcagagatgaagttgcctcc
cctgaagatggagctctgacactaacagtcaaaccacttgtgtgcctgctaccaccactg
tttaaacaaaacctgctgaccttcctctacttgctgcatcctgctatccctgtgcccgcc
gtcctcctgctgctcaaatgtcttggtgaggactccacccccaccccctgggtgacggct
atggttaggcaactagagaggaaactggaggtgaaccacacagatcctctgtactctgag
cagtgcagccagaaactaaagactctatctgaacgtttgggaggtttttgtgagactgga
ggttgggccgactgctttattagtcaaacagaggaatccgagtcacatgctagacctgat
ttatctcagcctggaactcaacggaaaagacgggccagtttggaccatgtggaagcagac
agcaaggaaatggttcaggagagtaaaaggatgaagatggacgaggatgtagaagaacta
gtagaagtagaagatgaaaaagtgaggttggacacaggagggggatcagaaactcctgca
aacagaatccatgatgacctacctgaacacatcaggggatctgttcttcttatgcaagag
ttactggaaagtcaggctgagtgggaccagagctctgcagatgtgtttcaagtgttaaat
gaatgcaacccaaaccaagtggagatgttatgcaagatgctgaattttcccatcttacct
gaagacacactgcctaagctgtgcaacgggattttgtgcctctctcctgacctgagctac
agtgctgcagcatcgctcattaggagtgtcctgctagagaaggtctcatccctgtcagaa
ccgccctccagatgtttggtaacagcggtaacttcgctgtgcagtcgctatcccaggccg
atgtgcctcgctgtgattgaaccagtgctgcaggacaggaacataggccctcctcagaca
gaactgctgaacaggctgatagaaaactgtctggatgtccattacaggctgcttgtactt
caaatgacgttccgggttccttggagtgaagcggttctctctgtccacagcttgctcgac
cataagctggttttgagtgaagaggtattcacacaattgactgaacagctcatcagccag
ggatctcagttcaccaagtcagtgaaatttgctaaaatgatgttaaccgttctcaccaaa
tacagcagccacgtgactgctgcacagaaacactctctggcaggctgcctgagtttaaat
gagactttcttgaagaaatctcttcaagctgctttgaaacgaatcccagacacatga

DBGET integrated database retrieval system