KEGG   Cyprinodon variegatus (sheepshead minnow): 107095363Help
Entry
107095363         CDS       T06110                                 

Gene name
mus81
Definition
(RefSeq) crossover junction endonuclease MUS81
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03440  Homologous recombination
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107095363 (mus81)
   03460 Fanconi anemia pathway
    107095363 (mus81)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107095363 (mus81)
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     107095363 (mus81)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     107095363 (mus81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC4 HHH_8
Motif
Other DBs
NCBI-GeneID: 107095363
NCBI-ProteinID: XP_015246901
Ensembl: ENSCVAG00000017842
UniProt: A0A3Q2G0P1
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MPDPEPVRFGRKRALPSCPNPLFLQWLTELRDEAKEKGLKIQYTYQKAINSLNKYPLPLK
NAKEAKILQNFGDGICKILDEKLQRYYRENGPNASIHCLPKGAPPPGQKDNNNRLAPPRK
RNDGSVEGKEKGGGGGTKRKKREYVPQKRSGGYAVLLTLYRQAQIPGSKGYMLKMELQTE
AQSLCDKSFTVPDLGSKYTAWSSVSTLIQKNLLIKTHNPARYSLTDEGLALAERLESVER
DVKNIPGEDISEGDGREEEEEERVVDLTESGDDDSDEEEQLPESLSQRATCAIQLSRDAG
EGSLQGKPQSTLTSIRKPNRESLLPGAYEILLCVDFIETTGGSHHRKQELVKELQRNGVA
FDVRKLNVGDFLWVAREKVTPVPGQLRAPVGRELVLDYIIERKRMDDLCGSIIDGRFREQ
KFRLKRCGLRKPIYLVEGSSSSAAHLSLPESTLQQAIVNTQVVDGFFVKRVQDVRESAAY
LTVMTRYLTKLYQNRTLFCRSRELEGDISSNEEEGGIPFCSLISFAEFNHGAVKNKCQTV
REVFARQLMQISGLSGDKAAAILGQYSSPHSLLAAYEKCGSEAEKEKLLSCIRYGKLKRL
AAYFIITD
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgccagacccggagccggttcggttcggtcggaaacgcgccctgccgtcctgtccgaac
ccgctgttcctccagtggctcaccgagctccgggacgaggcgaaggagaaaggcctgaag
atccagtacacctaccagaaggctataaactctttgaataaatatccacttccactaaaa
aacgctaaagaggcaaaaatccttcaaaactttggagacggaatctgcaaaatactggat
gagaagctgcagcgatactacagagaaaacggtcccaacgcttcaattcactgcttaccc
aaaggtgcgccccctcctggtcagaaagacaacaacaacaggctggctcctcccaggaag
aggaacgatggaagtgttgaagggaaggaaaagggaggaggtggaggaacaaagaggaag
aagagggaatacgtaccccagaagaggtctggaggatacgctgtactactcactctttac
agacaggcacagatcccaggtagtaaaggctacatgttaaagatggagctgcagacagaa
gctcagtctctctgtgacaaatcttttaccgtgcccgatcttggcagcaagtacaccgcc
tggtcctcagtcagcactctgatccagaaaaacctgctgataaagactcacaatcctgcc
aggtattctctgacggatgagggtctcgctttggctgaacgactggaatcagtggaaaga
gatgtgaaaaacattccaggagaggacattagtgaaggagatggacgagaggaggaagag
gaggaaagggttgttgatcttactgagagtggtgatgatgatagtgatgaagaggagcag
ctgcctgagagcctttcacaaagagcaacctgtgccattcagctgagcagggatgcaggc
gaggggtctctacaaggaaaaccgcagagtaccctgacatcaattagaaagccaaacaga
gaaagtcttctaccaggagcttatgagatcctcctgtgtgtcgacttcatagagaccact
ggtggcagccaccaccgtaagcaggagctggtcaaagagctgcagaggaacggagtcgcc
ttcgatgttaggaaactcaatgttggagacttcctgtgggtggctcgggaaaaggtcaca
cctgttccaggtcagctgcgagctcccgtagggagagagctggtcctcgattatatcatt
gagaggaagaggatggacgacctgtgtgggagcatcatcgacggacgctttagggaacaa
aagtttcgactgaagcgatgcggtctccgtaagcccatctacttggtagagggcagcagc
tcatccgctgctcacctgagtttacctgaaagcaccttgcagcaagccatcgtcaacaca
caggttgttgacggcttcttcgttaaaagagtccaagatgtccgcgagtcggccgcctac
ctcacagtcatgacccgatacctgaccaaactctaccagaaccgaaccctgttctgtcgc
tccagagagctggagggggacatatccagcaatgaagaggagggagggatccccttctgc
tctctcatttcttttgcagagtttaaccacggggctgtgaaaaacaagtgtcagacggtg
agagaagtgtttgctagacagctgatgcagatcagtgggttgtctggtgataaagcagca
gccatactggggcagtacagcagtccacatagtctcctagccgcttatgaaaagtgtggg
agtgaggcagagaaagagaaactcctctcctgcatccgatacgggaagttgaaaaggtta
gcagcatatttcatcattacagattaa

DBGET integrated database retrieval system