KEGG   Cyprinodon variegatus (sheepshead minnow): 107095494
Entry
107095494         CDS       T06110                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04020  Calcium signaling pathway
cvg04260  Cardiac muscle contraction
cvg04261  Adrenergic signaling in cardiomyocytes
cvg04270  Vascular smooth muscle contraction
cvg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107095494
   04020 Calcium signaling pathway
    107095494
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107095494
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107095494
   04261 Adrenergic signaling in cardiomyocytes
    107095494
   04270 Vascular smooth muscle contraction
    107095494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cvg04040]
    107095494
Ion channels [BR:cvg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107095494
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 107095494
NCBI-ProteinID: XP_015247103
Ensembl: ENSCVAG00000011363
LinkDB
Position
Unknown
AA seq 2216 aa
MMGNAASGGGAGLGSGGGGPISTASSTQRKRQHYASKPKKQTTTTATRPPRALLCLTLKN
PIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFT
VEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGF
DVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFM
GKMHKTCVYNHSGTNAEEKPAPCAPDGAYGRHCMQNGTKCQVGWEGPNDGITNFDNFAFA
MLTVFQCITMEGWTDVLYWVNDAVDYRWPWVYFVTLIIIGSFFVLNLVLGVLSGEFSKER
EKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNRKGRHFLSL
RGAVKKNAAFLRKALSMPASENESVNTDNAPGGDVEGETCCTRLATRISKSKFSRYSRRW
NRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHKQPQWLTDVQDIANKVLLALFTG
EMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFK
ITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDDTRRSTFDN
FPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI
AVDNLADAESLTSAQKEEEEAKERKKLARLASPEKRQENEKPPIEEKKSEKIELKSITSD
GETNTATKINMDDCCGEENEEKNPYPANDYIGDEDEDEPEMPVGPRPRPLSDIHLKEKAV
PMPEARAFFIFSHTNQFRVFCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQI
LGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQLDFST
SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIG
VQLFKGKFFFCSDSSKQTQAECRGSYIMYKDGDVGKPEKALRMWRNSDFNFDDVLQGMMA
LFAVSTFEGWPGLLYRAIDSHTEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIV
TFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFT
LILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFD
FLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSSSSHPHVVRPMGLQNSEENARISIT
FFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIA
LQDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNQPCEKGSTNETSSAHEDC
GSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLNVEEEMDKGMKESV
SAASEDDIFRRTGGLFGNHVNYYNQSDGRGSFPQSFTTQRPLHISQKGSPCEGESPSHEK
LMGSTTFTPSSYSSSGSNANLNNANNTGMTGVTPQGITRFPSPSISTVDGHTDQPLTPIL
LPRSAWCFPPKSSDSSDSRLPIIQRGEGSTEETYDESYGDDREYQDDEHSLSSDMLVYHD
ETCKQLTPMEEAEEVEGQRGGGGWQSPRRVFLCPTTLGRRASFHLECLRRHSRPDVSQKT
AVPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPPTSPTAQSSDASYQQVPSLRLEG
SNSHEKLNTSLPSVNCGPWYSDSNGNSPVASPSPTPGSSQRARRPVSLTVPSLLGKDPSS
LSHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAELADACDMTIEEMEHAASNIINGNTA
TNPASSTTPTSQHSPNGSLPCHNAAAAAVPHRDRVISLSPGDAGAEAGGVRGYIHGPSSI
EERQELLASGGGREEEEEETNVREERSHRSSAVVAGTQQNNSRLLEDDDLECVTSL
NT seq 6651 nt   +upstreamnt  +downstreamnt
atgatgggcaacgctgcttcaggcggcggggcgggacttgggtcaggtgggggcggcccc
atttctacagccagctccacgcaaaggaagagacaacactacgcttctaaacccaagaaa
caaaccacaacgacagccacaaggccgccaagggcactactctgtctcacactcaagaac
cctatccgccgggcttgcatcagcatcgtagagtggaaaccatttgagatcatcatcctg
atgaccatctttgctaactgtgtggccttagctgtctacatccccttccctgaggatgac
tctaatgccaccaactccaacctggagcgtgtggagtacctgttcctaatcatttttacg
gtggaggcgtttctcaaggtaatagcttacggcctgctcttccatcccaacgcctacctg
aggaacggctggaatctgcttgacttcatcattgtagtagtagggttattcagtgcgatt
ttggagcaggccacaaagggagatggggccactccgatcggagggaaggcggcaggcttt
gatgtcaaagctctgcgagcattcagagtcctaagaccgctacgactggtctctggagta
cccagtttacaagtcgtgttaaactccataatcaaagccatggttcctctgctccacatt
gccctcctggtccttttcgtcatcattatctatgccatcatcggcctggagctcttcatg
ggcaagatgcataagacctgcgtttacaaccactcaggcacaaatgcagaggaaaaacca
gcaccgtgtgcccctgatggagcttatggtcggcactgcatgcagaacggaacaaagtgc
caagttggttgggagggccccaatgatggcattaccaactttgacaactttgcctttgcc
atgctgacagtgttccagtgtataaccatggagggctggacggacgtgctgtactgggtg
aatgatgcagtagattacaggtggccttgggtctattttgtcaccttgatcatcatcggc
tccttctttgtgctaaacttggttttgggggtgttaagcggagagttttccaaggaaaga
gagaaggccaaagcacgcggtgacttccagaaactacgagaaaaacagcaactggaggaa
gacctaaagggctatttagactggataactcaggctgaagacattgacccagagaatgaa
gaagagggcttggatgatgacaaacccagaaaccgtaaaggtcgtcattttctctctctg
cgtggagccgtgaagaaaaacgcggcttttcttcgtaaggcgttgagtatgccagccagt
gaaaacgaatcagtcaacacagataacgcccccggaggagacgtggagggggagacatgc
tgcaccaggctggcaactaggatctccaaatccaagttcagtcgctactctcggaggtgg
aacaggttgtgtaggcgaaagtgtcgagcagcagtcaagtcccaggttttctattggctc
gtcatcttcttggtttttctcaacaccctgaccatcgcttctgaacatcacaagcaaccg
cagtggctaacagacgtacaagatatagcaaacaaagtattgttagcactcttcacgggt
gagatgctgctaaagatgtacagtcttggcttacaggcgtactttgtgtcgctcttcaac
cggtttgacagcttcgtagtatgtggaggaatactagaaaccattctagttgaaacaaag
atcatgtctcctcttggcatctcggtgttacgctgtgtgcgccttttaagaatatttaaa
ataacaagatattggaactctctctccaacctcgtggcctcactactcaactcagttcgc
tccatcgcctccctgctacttctgctctttctcttcatcattatcttctccctgttgggc
atgcagctctttggggggaaattcaactttgacgacacccgacgcagcacctttgacaac
ttcccgcagtctttgctcactgtgtttcagattctgacaggagaagactggaactctgtt
atgtatgatggcatcatggcgtacggcggcccatcttttcctggcatgctggtctgcatc
tactttatcatcctcttcatctgcggaaactacatcctactgaatgtcttcttggccatc
gctgttgacaatctagcagatgctgagagtctgacatcagctcagaaagaagaggaggag
gcaaaggagaggaaaaagctggcaaggctcgccagtccagagaagcgtcaggaaaacgag
aagccaccaatagaggaaaagaagagtgagaagattgaactgaagtctatcacttctgat
ggagagactaacactgccacaaagattaacatggatgactgttgcggagaggaaaatgaa
gagaagaatccatatcctgcaaatgattacataggagatgaggatgaggatgagccggag
atgccggtaggcccgaggccacggccactctctgatatccacctaaaagagaaggctgtt
ccaatgccagaggcccgcgccttcttcatcttcagccacactaatcaattcagggttttt
tgccacaagatcgtcaaccacaacatcttcaccaacctcatcctgttcttcatcctgctc
agcagcatcagtctggcagctgaggatccggtcaagaacgactcctttagaaatcagatc
ctgggctatgcagatcatgtctttactggactcttcaccattgagatcattcttaagatg
acagcatatggagctttcctccataaaggttcattttgtagaaactatttcaacatcctg
gacttggtagtggtcagcgtttctctcatttcttctgggatacaactagacttctcgacg
tccagtgcaattaatgttgtaaagatcctgagagtcctgcgagtgctgagaccgctgaga
gccatcaacagagccaaaggactaaagcatgttgtgcagtgtgtttttgtggccatcagg
accatcggcaacatcgtcattgtcactacgttgctccaattcatgttcgcctgtattgga
gtgcaactattcaagggcaagttcttcttctgtagtgacagctccaaacagactcaggca
gagtgcagaggttcctacatcatgtataaagatggggatgtagggaaaccagaaaaagcc
ctgagaatgtggaggaacagcgatttcaactttgatgatgtcctgcagggaatgatggct
ttgtttgctgtgtctacatttgaggggtggccagggttactgtaccgagccatagactct
cacactgaggatgttggtccaatctacaactaccgcgtggtcatctctatatttttcatc
atctacatcatcatcatcgcttttttcatgatgaacattttcgtcggtttcgtcatcgtc
acattccaggagcaaggagagcaggagtataagaactgtgagctggacaagaatcagcgt
caatgtgtggaatacgccttgaaggctcgtccgctgcgtcgctacattcccaagaaccct
taccagtacaaagtgtggtatgtggtcaactccacctactttgagtacctgatgttcaca
ctcatcctcctcaacactatctgtctggccatgcagcatcatgggcagaccaaaaatttc
aatgatgcaatgaacatcctcaacatgctcttcacaggacttttcacggtagagatgatc
ctaaaactaatcgccttcaagcccagggggtactttagtgatccctggaatgtgtttgat
ttcctcatcgtaattggcagcataatagacgtcattctcagtgagatcaacccagctgac
tcgtcctcgtcctcgtcctcctcctcctcctcctcttcctcttcttcctcctctcacccc
catgtggtaaggccaatgggacttcagaattctgaagagaacgccaggatctccatcacc
ttcttccggctgttccgcgtgatgaggctggtcaagctgctatctcgcggggaagggatt
cggaccctgctgtggaccttcatcaaatcgttccaagctctgccctatgtagctctgcta
atagtgatgctcttcttcatatacgctgtcatcggcatgcagatgtttggtaagatagca
ctgcaggaccacacgcagatcaacaggaacaacaatttccagacgttccctcaggcagtc
ctgctcctcttcagatgtgcgactggtgaggcgtggcaagagatcatgctggcatgctcg
cccaatcaaccatgcgagaaagggtcaaccaatgaaaccagctcagcccatgaggactgc
ggcagccagtttgccatcatttactttgtcagcttctacatgttgtgtgcctttctgatc
atcaacctctttgtggctgtaatcatggacaactttgactatctcacccgggactggtca
attttggggccacatcatcttgatgagtttaagaggatatgggcagaatatgacccagag
gctaaggggaggataaaacacctagatgtagtcactttgcttcggagaattcagcctcct
ctcggttttggaaagctctgtccacacagggtggcgtgcaagcgcctggtgtcaatgaat
atgcctctgaacagcgatggaaccgttatgttcaatgccacattgtttgcattggtcaga
actgccctcaggatcaagacagaaggtaatctagagcaggctaatgaggagctaagagca
attgtgaaaaagatttggaagagaaccagcatgaagctattggatcaagttgtgccccct
gctggtgatgatgaagttacagttggaaagttctatgccaccttcctcattcaggaatat
ttccgcaagtttaaaaagaggaaagaacaaggtctagtggccaaggtaccccccaaaacg
gccctttctctgcaggctggcctgcggacactgcacgacatcggtccagagataaggagg
gcgatctctggagacttgaatgtggaggaggagatggacaaaggcatgaaggagtcagtg
tcagctgcgtctgaagacgatatcttcaggcgcacaggtggcttgtttggcaaccatgtc
aactattacaaccagagtgatggtcgtggatccttcccacagtccttcactactcagcgt
ccgttgcacatcagccagaagggctctccttgcgaaggcgaaagcccgtcccacgagaag
ctgatgggctcgaccaccttcaccccttcatcttactcctcatcaggttcaaatgccaac
ctcaacaacgccaataacactggaatgacaggagtgactccccagggcatcacccgattc
ccaagcccatccataagcaccgtggacgggcacacagaccagccgctcacacccatcctg
ctgccaagatcagcatggtgcttccctccgaaaagctcggactcgagtgacagtcgtctg
ccaatcatccagagaggggaggggtcaacagaggagacatacgatgagagttatggtgac
gacagggagtaccaggatgatgagcactcactttcttctgacatgttggtgtatcatgat
gaaacatgtaagcagctgactccaatggaggaagcagaagaagtagagggacaaagagga
ggaggaggatggcagtctccaagaagagtcttcctctgtccaactactctgggacggaga
gcttctttccatctggagtgtcttcggagacattcgaggccagatgtttcccagaagact
gctgtacctttacatcttgtacatcatcaggctctggcagtggcagggttgagtcccctt
ttgagaaggagtcactcacctactctcttcagccggctgtgttccacccctccaaccagc
cccacagcccaaagcagtgatgcctcttaccagcaggttccctctctgaggctagagggg
tctaactctcatgaaaagctaaataccagcttgccttctgtcaattgtgggccctggtac
agtgacagtaatgggaatagtcctgtggccagtcctagccccacgccggggtcaagtcaa
cgagcacggcggccggtgtcacttactgtgccatcgcttttggggaaggacccgagctcg
ctctctcatggcagtgcaggcagcctggtggaagcggttcttatatcagaaggtttgggt
cattttgcccaggacccttccttcattgaggcaaccaaagccgagttggctgatgcctgc
gacatgaccattgaggagatggagcatgcagccagcaacattatcaacggcaacacagcc
acaaaccccgcatccagcaccactcccacctctcagcacagccccaatggcagcctgccc
tgccacaatgcagcagcagcagctgtaccgcacagggaccgagtcatcagtttgagtccg
ggtgacgccggggcagaggccggaggggtgagaggctacatccatggtccatcctctata
gaggagcgacaggaactgctagctagtgggggagggcgagaagaggaggaggaggaaaca
aatgtgagagaagagcgatcccacagaagttcagctgtggttgcaggaacgcaacagaac
aacagcaggcttttggaggatgacgatttggagtgcgttacgagcttgtag

DBGET integrated database retrieval system