KEGG   Cyprinodon variegatus (sheepshead minnow): 107096221
Entry
107096221         CDS       T06110                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04068  FoxO signaling pathway
cvg04110  Cell cycle
cvg04115  p53 signaling pathway
cvg04218  Cellular senescence
cvg04310  Wnt signaling pathway
cvg04340  Hedgehog signaling pathway
cvg04371  Apelin signaling pathway
cvg04510  Focal adhesion
cvg04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107096221 (ccnd1)
   04340 Hedgehog signaling pathway
    107096221 (ccnd1)
   04371 Apelin signaling pathway
    107096221 (ccnd1)
   04068 FoxO signaling pathway
    107096221 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107096221 (ccnd1)
   04115 p53 signaling pathway
    107096221 (ccnd1)
   04218 Cellular senescence
    107096221 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107096221 (ccnd1)
   04530 Tight junction
    107096221 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107096221
NCBI-ProteinID: XP_015248276
Ensembl: ENSCVAG00000002852
UniProt: A0A3Q2FER9
LinkDB
Position
Unknown
AA seq 292 aa
MEEQLLCCEVDSIRRAYQDENLLNDRVLQTMLKAEENYLPAPNYFKCVQKEIVPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKSRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLGKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDTSLSSANLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSGAVETKRMDEEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactcgatcaggagagcctaccaggacgag
aacctcctgaatgaccgagtcctccagaccatgctgaaggcggaggagaactacctaccg
gcccccaactactttaaatgtgttcagaaggagattgttcccaaaatgaggaaaatactg
gccacctggatgttggaggtctgtgaggagcagaagtgtgaggaggaggtttttccgctg
gcgatgaactatttagaccgattcttatcggtggaggccaccaggaagagcaggctgcag
ctgcttggagcgacctgcatgtttctagcatccaagatgaaggagacggtccctctgact
gcagagaagctctgcatctacacggacaactctgtgctaccaggagagctgctgcaaatg
gagctgctggttctgggtaaactgaagtgggatctggcttcagtcactcctcatgacttc
atcgagcacttcctgtccaagctgaagatccacccgtccaccaagcagatcctcaggaaa
cacgctcagaccttcgtggcgctctgtgcaacagatgttaactttatcgccagtcctcca
tcgatggttgcagcaggaagcgtggtggccgcggttcaaggcctctacctgaagagccaa
gacacgtccctgtcctcagccaacctcaccaacttcctgtcccaggtcatccgcagcgac
ccggactgcctgcggtcgtgccaagagcagatcgagtccctgctggagtccagcctgcgc
caggcccagcagcacagcggcgccgtggaaaccaaacgcatggacgaggaagctgacctg
tcctgcacacccacggacgtcagagacgtcaacatctga

DBGET integrated database retrieval system