KEGG   Cyprinodon variegatus (sheepshead minnow): 107096446Help
Entry
107096446         CDS       T06110                                 

Gene name
pms2
Definition
(RefSeq) mismatch repair endonuclease PMS2
  KO
K10858  DNA mismatch repair protein PMS2
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03430  Mismatch repair
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    107096446 (pms2)
   03460 Fanconi anemia pathway
    107096446 (pms2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107096446 (pms2)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     107096446 (pms2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-GeneID: 107096446
NCBI-ProteinID: XP_015248587
Ensembl: ENSCVAG00000018884
UniProt: A0A3Q2DBP9
LinkDB All DBs
Position
Unknown
AA seq 844 aa AA seqDB search
MSDVCTSESAGAIKAIDRHSVHQICSGQVVLSLATAVKELVENSIDAGATNVEVKLKECG
AEQIEVSDNGRGVEEANFEGLTLKHHTSKLRDFSDLIHVETFGFRGEALSSLCALSDLSV
ITCHQSSQVGTKLVFDHKGHLVQQSPCPRQPGTTVTLQQLFYTLPVRHKEFQRNIKKEYA
KMIHVLQAYCIISTGVRITCSNQNGQGKRSTVLSTSGSQSMRDNIGAIFGPKQLQSLLPF
HQVSAAENILEEYGLKAGDLPTPTFSITGFVSAGDHGVGRSVSDRQFFFINSRPCDPIKV
SKLVNEVYHMYNRHQYPFVALNIAVASDCVDVNVTPDKRQIFLQEEKLLLAILKTSLIAM
YEAGVNKISLNCAPTQMVAAASKEENKGEPAESDQPVAPSSKSTMNLAALKAAFSNQNSS
PCGSKAGTEKASGSGLSQRTLQCFFKDPVKSASTTLCTKSPLQPRTDAAKRSTGGRSVLD
AFRFGGTWNQDKPDNEGDQAEPTGDSAEQSPCTEYSEVTGPVVESVENDSSVSQNEAEDL
DLQTKAGSATEDSMISPEAKRPRTDSPLLKVEQSSENLSDTPPSTVDVPVSLQRKAVPLR
FSLQDLTASMKRLQEQQRQRAGEKLHYRRFRAKINPGENQSAEDELRREISKEMFKEMEI
IGQFNLGFIITKLNSDIFMIDQHASDEKYNFEMLQQHTVLQGQKLIVPQKLHLTAVSENV
LIENLEIFQKNGFEFLIDEDAQVMERVKLVSLPTSKNWTFGPADIEELIFMLTDSPGVMC
RPSRVRQMFASRACRKSVMIGTALSVGEMKKLVLHMGEIKHPWNCPHGRPTMRHLANLEM
ISQD
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtttgcacctctgagtctgctggggctataaaggccattgaccgtcactca
gtccatcagatctgctcaggacaagtagttctgagtttggccacagctgtcaaagagttg
gtggagaacagcatagatgcaggagccaccaatgttgaggtcaagctgaaggagtgtggc
gctgaacaaatcgaagtatcagacaacggcagaggggttgaagaagcaaactttgaagga
ctgactctaaagcatcacacatcaaagctgagagatttctccgatctgatccatgtggaa
acatttggctttcgaggtgaagccctgagctctctgtgtgctctaagtgacctgagtgtg
attacatgccatcagtccagccaagtaggcaccaaattggtgtttgaccacaaaggccat
cttgtgcagcagtcgccctgtcccaggcagccaggcaccaccgtcactctgcagcagctc
ttctacactctgcctgttagacacaaggagttccagcgtaacatcaagaaggagtacgcc
aaaatgatccacgtcctgcaggcctactgcatcatctccacaggagtgcgtatcacctgc
tccaaccaaaatgggcaggggaagcgtagcactgtcctcagcaccagcggcagccaaagt
atgagagacaacatcggcgccatattcggaccaaagcagcttcagagtcttcttcctttc
caccaagtatctgctgcagagaacattctggaggaatacggacttaaagctggagattta
cccacaccaactttttcaatcacaggcttcgtgtctgccggggaccacggcgttgggcgg
agcgtctcagacaggcagttcttcttcatcaacagccgcccatgtgaccccattaaggtc
agcaaacttgtgaatgaagtctaccacatgtataacagacatcagtatccattcgttgct
ctcaacatagctgtggcctcagactgtgtggatgtgaatgtaacccctgataaacgacaa
atcttccttcaagaggagaaactcctacttgccatcctaaagacttccctcatcgctatg
tatgaagctggagttaataagatcagtctgaactgtgcaccaactcagatggttgcagct
gcttctaaagaagaaaacaagggagaaccagcagagagtgaccaacctgtggctcccagt
tcaaagtcaaccatgaacctggctgccctcaaagctgctttttcaaaccagaacagttcc
ccctgtgggagtaaggcggggactgaaaaagcgtctggtagtgggctgagccagaggacg
ctgcagtgtttctttaaagatccggttaaatctgccagcaccaccctgtgtacgaagtca
cctttacagcccagaacagatgcagctaaacgcagcacaggggggaggtctgtgctcgat
gcgtttaggtttggagggacatggaaccaggataaaccggacaatgagggagaccaggct
gagcccactggtgacagtgcagaacagtctccatgtacagagtactccgaagtcactgga
ccggttgttgaaagtgtagaaaatgactcatcagtcagccaaaacgaagctgaggacctg
gatctacaaactaaagcaggttcagctacggaggactccatgattagcccggaagctaaa
aggcccagaacagattctccacttctcaaggtggaacaaagttctgaaaacctttcagat
acacctccttctacagtggacgtccctgtctctctgcagaggaaggccgtgcctttgcgt
ttctcactgcaagacctgacggctagcatgaagaggctgcaggaacagcagagacagaga
gctggagaaaagctgcactacaggcgcttcagggccaagatcaaccctggagaaaaccaa
agcgcagaggatgagctccgcagagagattagtaaggaaatgtttaaagaaatggagatt
atcggtcagtttaacctgggtttcatcatcaccaagctgaactcggacatctttatgatc
gatcagcacgccagcgatgagaaatacaactttgagatgctgcagcagcacactgtgctt
caggggcagaaacttatcgtcccacagaaacttcacctcactgcagtcagcgagaacgtg
ctcatagagaacctggagatcttccagaagaacggctttgaatttctgatcgatgaggac
gctcaggtgatggagagggtgaagctggtctctttgcccaccagtaaaaactggaccttc
ggcccggcagacattgaagagctgatcttcatgttgactgacagcccaggcgtcatgtgc
cgcccatccagagtcaggcagatgtttgcctctcgagcgtgcaggaaatcagtgatgatc
gggacggctctaagcgtcggtgagatgaagaagctcgttctgcacatgggggagatcaag
catccgtggaactgtcctcacggcaggcccaccatgcgacacctcgccaacctggaaatg
atctcacaggactga

DBGET integrated database retrieval system